Result : Q6NH60
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0237 protein DIP1286 |
| NCBI Accession ID | BX248357.1 |
| Organism | Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) |
| Left | 257543 |
| Right | 257812 |
| Strand | + |
| Nucleotide Sequence | ATGTTTGCCATTATCTCTGTCACCGGTGCAGATCACACCGGAATCATCGCTGCTGTAGCTACAAAATGCGCCGACTTGGGCGTTAACATCAACAATGTTTCTCAAACGATCATGGACGGTTACTTCACCATGATCCTGCACGTATCCTTTGATGATTCTGCAACAGATATTGCCACAATTCAGGAATCAATGGCAGATGTAGAAAAGGATCAAAACCTGGTGATTCGAATTCAATCTCAGGCAATCTTCGACGCAATGAATATCATCTAG |
| Sequence | MFAIISVTGADHTGIIAAVATKCADLGVNINNVSQTIMDGYFTMILHVSFDDSATDIATIQESMADVEKDQNLVIRIQSQAIFDAMNII |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding. |
| Pubmed ID | 14602910 |
| Domain | CDD:415594 |
| Functional Category | Others |
| Uniprot ID | Q6NH60 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1278028 | 1278297 | + | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 2 | 1263342 | 1263611 | + | NZ_LR738855.1 | Corynebacterium rouxii |
| 3 | 1177240 | 1177509 | + | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 4 | 283755 | 284024 | + | NZ_LT906443.1 | Corynebacterium ulcerans |
| 5 | 1167669 | 1167938 | - | NZ_CP035299.1 | Corynebacterium pelargi |
| 6 | 1167892 | 1168161 | - | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 7 | 1208545 | 1208814 | + | NZ_CP033897.1 | Corynebacterium gerontici |
| 8 | 1781728 | 1781997 | + | NZ_CP011542.1 | Corynebacterium mustelae |
| 9 | 1768215 | 1768484 | + | NZ_AP017369.1 | Corynebacterium suranareeae |
| 10 | 1594723 | 1594992 | + | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 11 | 1148204 | 1148473 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 12 | 1755934 | 1756203 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 13 | 1518783 | 1519052 | + | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 14 | 1546057 | 1546326 | - | NZ_LS483459.1 | Corynebacterium jeikeium |
| 15 | 1279433 | 1279702 | - | NZ_CP009247.1 | Corynebacterium frankenforstense DSM 45800 |
| 16 | 1368273 | 1368542 | + | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 17 | 1087180 | 1087449 | - | NZ_CP008944.1 | Corynebacterium atypicum |
| 18 | 1636609 | 1636878 | + | NC_020302.1 | Corynebacterium halotolerans YIM 70093 = DSM 44683 |
| 19 | 1331558 | 1331827 | + | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 20 | 662782 | 663048 | + | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 21 | 1839224 | 1839490 | - | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
| 22 | 1302122 | 1302391 | + | NZ_CP011311.1 | Corynebacterium camporealensis |
| 23 | 5183 | 5452 | + | NZ_CP068161.1 | Corynebacterium propinquum |
| 24 | 1596686 | 1596955 | + | NZ_CP068168.1 | Corynebacterium amycolatum |
| 25 | 1427860 | 1428129 | + | NZ_CP011545.1 | Corynebacterium testudinoris |
| 26 | 1502183 | 1502452 | + | NC_021915.1 | Corynebacterium maris DSM 45190 |
| 27 | 1215508 | 1215777 | + | NZ_CP049889.1 | Jeotgalibaca porci |
| 28 | 2628074 | 2628343 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 29 | 264694 | 264963 | + | NZ_CP014635.1 | Corynebacterium simulans |
| 30 | 1399163 | 1399432 | + | NZ_CP009246.1 | Corynebacterium flavescens |
| 31 | 1298031 | 1298300 | + | NZ_CP039247.1 | Corynebacterium endometrii |
| 32 | 1394721 | 1394990 | + | NZ_CP009312.1 | Lawsonella clevelandensis |
| 33 | 1424979 | 1425248 | + | NZ_CP009251.1 | Corynebacterium stationis |
| 34 | 1064318 | 1064587 | + | NZ_CP046883.1 | Corynebacterium anserum |
| 35 | 2138258 | 2138527 | - | NZ_CP056080.1 | Rothia nasimurium |
| 36 | 795140 | 795406 | - | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 37 | 1122268 | 1122537 | + | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 38 | 1097631 | 1097900 | - | NZ_LT906473.1 | Corynebacterium cystitidis |
| 39 | 1265271 | 1265540 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 40 | 2027784 | 2028050 | + | NZ_LS483464.1 | Corynebacterium renale |
| 41 | 2177735 | 2178004 | - | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 42 | 1032125 | 1032394 | - | NZ_CP040635.1 | Acidipropionibacterium jensenii |
| 43 | 1356852 | 1357121 | - | NZ_CP067012.1 | Corynebacterium kefirresidentii |
| 44 | 2287948 | 2288217 | + | NZ_LR134442.1 | Propionibacterium australiense |
| 45 | 1025082 | 1025351 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 46 | 1486406 | 1486675 | + | NZ_LR698967.1 | Corynebacterium ammoniagenes |
| 47 | 1368174 | 1368443 | + | NC_014643.1 | Rothia dentocariosa ATCC 17931 |
| 48 | 1821719 | 1821988 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 49 | 1416842 | 1417111 | - | NZ_CP010827.1 | Corynebacterium singulare |
| 50 | 1393044 | 1393313 | + | NZ_LS483460.1 | Corynebacterium minutissimum |
| 51 | 1288368 | 1288649 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 52 | 1481909 | 1482172 | + | NZ_CP006764.1 | Corynebacterium doosanense CAU 212 = DSM 45436 |
| 53 | 580855 | 581124 | - | NZ_CP017812.1 | Boudabousia tangfeifanii |
| 54 | 1190913 | 1191176 | - | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 55 | 1364624 | 1364893 | - | NC_012590.1 | Corynebacterium aurimucosum ATCC 700975 |
| 56 | 2153374 | 2153643 | - | NZ_CP061539.1 | Rothia terrae |
| 57 | 1501425 | 1501694 | - | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 58 | 2034421 | 2034690 | - | NZ_CP019400.1 | Acidipropionibacterium acidipropionici |
| 59 | 2258063 | 2258332 | - | NZ_LR134479.1 | Rothia aeria |
| 60 | 2123436 | 2123702 | + | NZ_CP008802.1 | Actinotignum schaalii |
| 61 | 1186830 | 1187093 | + | NZ_CP011546.1 | Corynebacterium uterequi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN831026.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00440.25 | 0.61 | 37 | 862 | same-strand | Bacterial regulatory proteins, tetR family |
| 2 | PF05167.14 | 1.0 | 61 | 14 | same-strand | Uncharacterised ACR (DUF711) |
++ More..