Result : Q6NE58
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Magnetosome protein MamL |
| NCBI Accession ID | HG794546.1 |
| Organism | Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) |
| Left | 2496698 |
| Right | 2496934 |
| Strand | - |
| Nucleotide Sequence | ATGGTAAGAGTGATCGGATCGTTGGTGTTCGGCGGCTTGATCCTGCTGCTGGCATCGTCCAACGCCCATATGGTGGAAACCCGATTTGGGCCACTGATAATGCTTGCGCCACATTTCGTGGTTCTTGGCATTACGTTTTTTCTTGGTTTCGCCATTGGGATTGTGTTGGTGTTTGCGAATGTTATGAAACGGCGCAAGCATAAACTGCCTGGGAAAAACATCGTCATTAAGCGCTGA |
| Sequence | MVRVIGSLVFGGLILLLASSNAHMVETRFGPLIMLAPHFVVLGITFFLGFAIGIVLVFANVMKRRKHKLPGKNIVIKR |
| Source of smORF | Swiss-Prot |
| Function | Involved in magnetite crystal maturation, but not in magnetosome vesicle tubulation or formation. One of 7 genes (mamLQBIEMO) able to induce magnetosome membrane biogenesis; coexpression of mamLQRBIEMO in a deletion of the 17 gene mamAB operon restores magnetosome vesicle formation but not magnetite biosynthesis. {ECO:0000269|Pubmed:27286560}. |
| Pubmed ID | 13129949 16237001 17449609 24625872 22043287 24816605 27286560 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q6NE58 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2496698 | 2496934 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 2 | 1028017 | 1028253 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 3 | 438208 | 438402 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_023065.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07719.19 | 1.0 | 2 | 5149.0 | same-strand | Tetratricopeptide repeat |
| 2 | PF00515.30 | 1.0 | 2 | 5149.0 | same-strand | Tetratricopeptide repeat |
| 3 | PF14559.8 | 1.0 | 2 | 5149.0 | same-strand | Tetratricopeptide repeat |
| 4 | PF13432.8 | 1.0 | 2 | 5149.0 | same-strand | Tetratricopeptide repeat |
| 5 | PF13181.8 | 1.0 | 2 | 5149.0 | same-strand | Tetratricopeptide repeat |
| 6 | PF13424.8 | 1.0 | 2 | 5149.0 | same-strand | Tetratricopeptide repeat |
| 7 | PF12895.9 | 1.0 | 2 | 5149.0 | same-strand | Anaphase-promoting complex, cyclosome, subunit 3 |
| 8 | PF18509.3 | 1.0 | 2 | 2683 | same-strand | Magnetochrome domain |
| 9 | PF01925.21 | 1.0 | 2 | 2361.0 | same-strand | Sulfite exporter TauE/SafE |
| 10 | PF13365.8 | 1.0 | 2 | 2542 | same-strand | Trypsin-like peptidase domain |
| 11 | PF03600.18 | 1.0 | 2 | 1007.0 | same-strand | Citrate transporter |
| 12 | PF01545.23 | 1.0 | 2 | 50.0 | same-strand | Cation efflux family |
| 13 | PF16916.7 | 1.0 | 2 | 50.0 | same-strand | Dimerisation domain of Zinc Transporter |
| 14 | PF06723.15 | 1.0 | 2 | 54.5 | same-strand | MreB/Mbl protein |
| 15 | PF17820.3 | 1.0 | 2 | 2556 | same-strand | PDZ domain |
| 16 | PF13180.8 | 1.0 | 2 | 2556 | same-strand | PDZ domain |
| 17 | PF00595.26 | 1.0 | 2 | 2619.5 | same-strand | PDZ domain |
| 18 | PF00089.28 | 1.0 | 2 | 2556 | same-strand | Trypsin |
++ More..