Protein Information |
Information Type | Description |
---|---|
Protein name | Magnetosome protein MamR |
NCBI Accession ID | HG794546.1 |
Organism | Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) |
Left | 2489792 |
Right | 2490046 |
Strand | - |
Nucleotide Sequence | TTGATTTGGACAGCAGTGATCAAGGGAAGTGCCTTGATGACCTTTGTTCAGGGCGCCATGGCTCTGGTGGACAAGGTATTTGGCGAGGAAATTCTGCCGCACCGCATCTATAGCAGCGGTGAAGCGGCGCAGTTGCTGGGAATGGAACGGCTGCAGGTGCTTGAGATGGTCCGGGCGGGGACGATCAAGGCGAAGAAGGTTGGCGATAATTATCGAATCCTGGGCTCCAATCTTGTGGAATACATGAACCGATGA |
Sequence | MIWTAVIKGSALMTFVQGAMALVDKVFGEEILPHRIYSSGEAAQLLGMERLQVLEMVRAGTIKAKKVGDNYRILGSNLVEYMNR |
Source of smORF | Swiss-Prot |
Function | May play a role in controlling magnetite number and size (Probable). Coexpression of mamLQRBIEMO in a deletion of the 17 gene mamAB operon restores magnetosome vesicle formation but not magnetite biosynthesis (Pubmed:27286560). {ECO:0000269|Pubmed:27286560, ECO:0000305|Pubmed:24816605}. |
Pubmed ID | 13129949 16237001 17449609 24625872 14766587 22043287 24816605 27286560 |
Domain | CDD:413393 |
Functional Category | Others |
Uniprot ID | Q6NE51 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2489792 | 2490046 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
2 | 1034936 | 1035190 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
3 | 1068179 | 1068433 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF18509.3 | 1.0 | 2 | 1553 | same-strand | Magnetochrome domain |
2 | PF01545.23 | 1.0 | 2 | -3.0 | same-strand | Cation efflux family |
3 | PF16916.7 | 1.0 | 2 | -3.0 | same-strand | Dimerisation domain of Zinc Transporter |
4 | PF04011.14 | 1.0 | 2 | -3 | same-strand | LemA family |
5 | PF07719.19 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
6 | PF00515.30 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
7 | PF14559.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
8 | PF13432.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
9 | PF13181.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
10 | PF13424.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
11 | PF12895.9 | 1.0 | 2 | 865.5 | same-strand | Anaphase-promoting complex, cyclosome, subunit 3 |
12 | PF01925.21 | 1.0 | 2 | 2401.0 | same-strand | Sulfite exporter TauE/SafE |
13 | PF13365.8 | 1.0 | 2 | 2401.0 | same-strand | Trypsin-like peptidase domain |
14 | PF03600.18 | 1.0 | 2 | 4347.5 | same-strand | Citrate transporter |