Result : Q6NE51
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Magnetosome protein MamR |
| NCBI Accession ID | HG794546.1 |
| Organism | Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) |
| Left | 2489792 |
| Right | 2490046 |
| Strand | - |
| Nucleotide Sequence | TTGATTTGGACAGCAGTGATCAAGGGAAGTGCCTTGATGACCTTTGTTCAGGGCGCCATGGCTCTGGTGGACAAGGTATTTGGCGAGGAAATTCTGCCGCACCGCATCTATAGCAGCGGTGAAGCGGCGCAGTTGCTGGGAATGGAACGGCTGCAGGTGCTTGAGATGGTCCGGGCGGGGACGATCAAGGCGAAGAAGGTTGGCGATAATTATCGAATCCTGGGCTCCAATCTTGTGGAATACATGAACCGATGA |
| Sequence | MIWTAVIKGSALMTFVQGAMALVDKVFGEEILPHRIYSSGEAAQLLGMERLQVLEMVRAGTIKAKKVGDNYRILGSNLVEYMNR |
| Source of smORF | Swiss-Prot |
| Function | May play a role in controlling magnetite number and size (Probable). Coexpression of mamLQRBIEMO in a deletion of the 17 gene mamAB operon restores magnetosome vesicle formation but not magnetite biosynthesis (Pubmed:27286560). {ECO:0000269|Pubmed:27286560, ECO:0000305|Pubmed:24816605}. |
| Pubmed ID | 13129949 16237001 17449609 24625872 14766587 22043287 24816605 27286560 |
| Domain | CDD:413393 |
| Functional Category | Others |
| Uniprot ID | Q6NE51 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2489792 | 2490046 | - | NC_023065.1 | Magnetospirillum gryphiswaldense MSR-1 v2 |
| 2 | 1034936 | 1035190 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 3 | 1068179 | 1068433 | + | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_023065.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18509.3 | 1.0 | 2 | 1553 | same-strand | Magnetochrome domain |
| 2 | PF01545.23 | 1.0 | 2 | -3.0 | same-strand | Cation efflux family |
| 3 | PF16916.7 | 1.0 | 2 | -3.0 | same-strand | Dimerisation domain of Zinc Transporter |
| 4 | PF04011.14 | 1.0 | 2 | -3 | same-strand | LemA family |
| 5 | PF07719.19 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
| 6 | PF00515.30 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
| 7 | PF14559.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
| 8 | PF13432.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
| 9 | PF13181.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
| 10 | PF13424.8 | 1.0 | 2 | 865.5 | same-strand | Tetratricopeptide repeat |
| 11 | PF12895.9 | 1.0 | 2 | 865.5 | same-strand | Anaphase-promoting complex, cyclosome, subunit 3 |
| 12 | PF01925.21 | 1.0 | 2 | 2401.0 | same-strand | Sulfite exporter TauE/SafE |
| 13 | PF13365.8 | 1.0 | 2 | 2401.0 | same-strand | Trypsin-like peptidase domain |
| 14 | PF03600.18 | 1.0 | 2 | 4347.5 | same-strand | Citrate transporter |
++ More..