Result : Q6MX40
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable endoribonuclease MazF1 (EC 3.1.-.-) (Probable toxin MazF1) |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 547076 |
| Right | 547357 |
| Strand | - |
| Nucleotide Sequence | ATGCTGCGCGGTGAGATCTGGCAGGTCGACCTGGATCCGGCCCGCGGCAGCGCGGCAAATATGCGGCGGCCAGCGGTAATTGTCAGCAACGACAGGGCCAACGCTGCCGCGATACGTCTCGACCGAGGCGTGGTGCCGGTTGTCCCGGTTACCAGCAACACCGAAAAGGTCCCCATTCCAGGTGTTGTTGCCGGCAGCGAGCGGTGGCCTGGCCGTCGATTCGAAGGCGCAGGCCCAGCAGGTTGGATCCGTCGCTGCGCAACGTCTCCCCTGCCGAGCTGA |
| Sequence | MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVVPVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type II toxin-antitoxin (TA) system, its cognate antitoxin is MazE1 (Probable). Probably an endoribonuclease (By similarity). {ECO:0000250|UniProtKB:P9WIH9, ECO:0000305}. |
| Pubmed ID | 9634230 15718296 16611633 |
| Domain | |
| Functional Category | Toxin_type_2 |
| Uniprot ID | Q6MX40 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 547076 | 547357 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 557356 | 557637 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00823.21 | 1.0 | 2 | 2344.5 | opposite-strand | PPE family |
| 2 | PF18878.2 | 1.0 | 2 | 2344.5 | opposite-strand | PPE-PPW subfamily C-terminal region |
| 3 | PF16877.7 | 1.0 | 2 | 1255.0 | same-strand | Domain of unknown function (DUF5078) |
| 4 | PF00378.22 | 1.0 | 2 | 273.0 | same-strand | Enoyl-CoA hydratase/isomerase |
| 5 | PF00326.23 | 1.0 | 2 | 229.0 | same-strand | Prolyl oligopeptidase family |
| 6 | PF02897.17 | 1.0 | 2 | 229.0 | same-strand | Prolyl oligopeptidase, N-terminal beta-propeller domain |
| 7 | PF00171.24 | 1.0 | 2 | 2318.0 | opposite-strand | Aldehyde dehydrogenase family |
| 8 | PF05610.13 | 1.0 | 2 | 3841.0 | opposite-strand | Protein of unknown function (DUF779) |
| 9 | PF16936.7 | 1.0 | 2 | 4353.0 | opposite-strand | Putative holin |
++ More..