Result : Q6MSM7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | BX293980.2 |
| Organism | Mycoplasma mycoides subsp. mycoides SC (strain PG1) |
| Left | 841559 |
| Right | 841843 |
| Strand | - |
| Nucleotide Sequence | ATGCACATCACTGAAGTATTAAAAAAACCAGTATTAACTGAAAAATCATTTGCTGGTCATAAAGATAATGTGTATACATTCTTAGTTGATAAAAAAGCTAATAAAGTTCAAATTAAAAAGACTTTTGAAGAAATTTTTGAAGTAAAAGTTGAATCAGTTAGAACTATTAATTATGATGCTAAAGAAAAAAGATTAGGAAAATATGTTGGCAAAAAACCATCATATAAAAAAGCAATCATTACATTAAAAGAAGGTCAAAAATTAGACGTGCTAAGCGACTTATAG |
| Sequence | MHITEVLKKPVLTEKSFAGHKDNVYTFLVDKKANKVQIKKTFEEIFEVKVESVRTINYDAKEKRLGKYVGKKPSYKKAIITLKEGQKLDVLSDL |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 14762060 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6MSM7 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 137
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 812129 | 812413 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 2 | 810028 | 810312 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 3 | 170820 | 171104 | + | NZ_CP023173.1 | Mesoplasma chauliocola |
| 4 | 154679 | 154963 | + | NZ_CP024964.1 | Entomoplasma melaleucae |
| 5 | 148645 | 148929 | + | NC_006055.1 | Mesoplasma florum L1 |
| 6 | 146816 | 147100 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 7 | 149527 | 149811 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
| 8 | 159518 | 159808 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 9 | 793718 | 794008 | - | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 10 | 154809 | 155093 | + | NZ_CP024965.1 | Entomoplasma somnilux |
| 11 | 146919 | 147203 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 12 | 1069980 | 1070264 | - | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 13 | 1176392 | 1176676 | - | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 14 | 1080453 | 1080737 | - | NC_022998.1 | Spiroplasma apis B31 |
| 15 | 27981 | 28265 | + | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 16 | 229892 | 230176 | + | NZ_CP024870.1 | Spiroplasma clarkii |
| 17 | 1093367 | 1093651 | - | NZ_CP022535.1 | Spiroplasma corruscae |
| 18 | 1182967 | 1183251 | - | NZ_CP012328.1 | Spiroplasma turonicum |
| 19 | 983604 | 983888 | - | NZ_CP017015.1 | Spiroplasma helicoides |
| 20 | 1267991 | 1268275 | - | NZ_CP043026.1 | Spiroplasma chinense |
| 21 | 1081968 | 1082252 | - | NZ_CP012357.1 | Spiroplasma litorale |
| 22 | 398883 | 399167 | + | NZ_CP031376.1 | Spiroplasma alleghenense |
| 23 | 1180184 | 1180468 | - | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 24 | 991205 | 991489 | - | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 25 | 1057496 | 1057780 | - | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 26 | 1086643 | 1086927 | - | NZ_CP012622.1 | Spiroplasma cantharicola |
| 27 | 356796 | 357080 | + | NZ_CP024963.1 | Entomoplasma luminosum |
| 28 | 814223 | 814507 | - | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 29 | 853365 | 853649 | - | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 30 | 171237 | 171542 | + | NZ_CP024962.1 | Entomoplasma freundtii |
| 31 | 855726 | 856010 | - | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 32 | 263181 | 263468 | + | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 33 | 289535 | 289822 | + | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 34 | 306365 | 306652 | + | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 35 | 632857 | 633144 | - | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 36 | 290301 | 290588 | + | NZ_CP013197.1 | Spiroplasma citri |
| 37 | 222721 | 223008 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 38 | 242879 | 243166 | + | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 39 | 220030 | 220317 | + | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 40 | 463179 | 463466 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 41 | 2259110 | 2259346 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 42 | 2307368 | 2307604 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 43 | 2663366 | 2663596 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 44 | 1980149 | 1980424 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 45 | 651627 | 651902 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 46 | 35587 | 35817 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 47 | 2590688 | 2590981 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 48 | 1279694 | 1279969 | + | NZ_CP027770.1 | Staphylococcus felis |
| 49 | 305569 | 305823 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 50 | 470981 | 471235 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 51 | 809284 | 809568 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 52 | 1405154 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 53 | 2174185 | 2174475 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 54 | 2660564 | 2660794 | - | NZ_HG917868.1 | Clostridium bornimense |
| 55 | 3536640 | 3536873 | - | NZ_CP030775.1 | Clostridium butyricum |
| 56 | 946001 | 946285 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 57 | 195327 | 195560 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 58 | 1508172 | 1508447 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 59 | 2597336 | 2597581 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 60 | 3350324 | 3350614 | - | NZ_CP040924.1 | Clostridium thermarum |
| 61 | 610731 | 611006 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 62 | 237286 | 237516 | + | NC_008593.1 | Clostridium novyi NT |
| 63 | 246739 | 246972 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 64 | 192366 | 192599 | + | NZ_CP043998.1 | Clostridium diolis |
| 65 | 2936494 | 2936760 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 66 | 4212092 | 4212349 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 67 | 3269677 | 3269910 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 68 | 1769971 | 1770246 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 69 | 705695 | 705970 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 70 | 2292914 | 2293207 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 71 | 1940357 | 1940587 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 72 | 1942417 | 1942710 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 73 | 2013261 | 2013554 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 74 | 345083 | 345313 | + | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 75 | 220435 | 220668 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 76 | 1728916 | 1729191 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 77 | 2011400 | 2011633 | + | NZ_CP023671.1 | Clostridium septicum |
| 78 | 1784087 | 1784362 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 79 | 756121 | 756396 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 80 | 233484 | 233738 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 81 | 415983 | 416276 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 82 | 208937 | 209212 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 83 | 896648 | 896923 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 84 | 2201211 | 2201486 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 85 | 1223454 | 1223687 | - | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 86 | 1288093 | 1288377 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 87 | 3187433 | 3187672 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 88 | 1473370 | 1473606 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 89 | 234823 | 235056 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 90 | 3720396 | 3720683 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 91 | 1962648 | 1962941 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 92 | 354642 | 354935 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 93 | 2256120 | 2256413 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 94 | 769750 | 770025 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 95 | 723120 | 723395 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 96 | 2316216 | 2316491 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 97 | 709406 | 709681 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 98 | 761492 | 761767 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 99 | 2170601 | 2170876 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 100 | 252931 | 253161 | + | NZ_CP016786.1 | Clostridium isatidis |
| 101 | 1437905 | 1438180 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 102 | 757741 | 758037 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 103 | 978375 | 978608 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 104 | 2426452 | 2426682 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 105 | 3935622 | 3935918 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 106 | 789811 | 790086 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 107 | 272259 | 272489 | + | NC_022549.1 | Acholeplasma brassicae |
| 108 | 2079049 | 2079336 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 109 | 47589 | 47828 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 110 | 2688082 | 2688357 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 111 | 1979260 | 1979535 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 112 | 181189 | 181476 | + | NZ_CP034118.1 | Staphylospora marina |
| 113 | 474497 | 474778 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 114 | 143501 | 143731 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 115 | 1452314 | 1452550 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 116 | 221369 | 221650 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 117 | 1825868 | 1826101 | - | NZ_CP035130.1 | Gudongella oleilytica |
| 118 | 1403454 | 1403693 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 119 | 470795 | 471031 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 120 | 506516 | 506752 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 121 | 2373350 | 2373580 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 122 | 170461 | 170691 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 123 | 85600 | 85836 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 124 | 138305 | 138535 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 125 | 2104552 | 2104791 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 126 | 3450658 | 3450888 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 127 | 1628319 | 1628549 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 128 | 1513139 | 1513432 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 129 | 1229676 | 1229909 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 130 | 874574 | 874804 | - | NC_016751.1 | Marinitoga piezophila KA3 |
| 131 | 2518284 | 2518517 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 132 | 502372 | 502605 | + | NZ_CP030280.1 | Blautia argi |
| 133 | 143568 | 143855 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 134 | 754477 | 754710 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 135 | 649699 | 649929 | + | NZ_CP014176.1 | Clostridium argentinense |
| 136 | 4559802 | 4560032 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 137 | 2734186 | 2734419 | + | NZ_LR130778.1 | Petrocella atlantisensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019903.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00237.21 | 0.99 | 136 | 1218.5 | same-strand | Ribosomal protein L22p/L17e |
| 2 | PF00181.25 | 1.0 | 137 | 46 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00338.24 | 1.0 | 137 | 1399 | same-strand | Ribosomal protein S10p/S20e |
| 4 | PF07650.19 | 0.8 | 110 | 1612.0 | same-strand | KH domain |
| 5 | PF00189.22 | 0.81 | 111 | 1612 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF00203.23 | 0.72 | 99 | 924 | same-strand | Ribosomal protein S19 |
| 7 | PF00573.24 | 0.72 | 98 | 33.0 | same-strand | Ribosomal protein L4/L1 family |
| 8 | PF03947.20 | 0.72 | 98 | 32.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 9 | PF00252.20 | 0.71 | 97 | 2273 | same-strand | Ribosomal protein L16p/L10e |
++ More..