Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | BX842646.1 |
Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
Left | 184857 |
Right | 185081 |
Strand | + |
Nucleotide Sequence | ATGGATTTTGAGAAGAAACTAGGCCGTCTTGAAGAGATCGTGCAAAAGATGGAAAAAGGCGATCTGGCTTTGGAAGAGTCTTTGAAGCTGTTCGAGGAAGGTGTGAAGCTTTCCCGCGAATGCCATCAGCGTCTGAATGAAGCTGAATCCAAAGTGAAACTGTTGATGTCTGTGGGAGCTGACGGCCAGCCGGTGACCACTGATTTCACTTCAGAGGAGAACTAA |
Sequence | MDFEKKLGRLEEIVQKMEKGDLALEESLKLFEEGVKLSRECHQRLNEAESKVKLLMSVGADGQPVTTDFTSEEN |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 14752164 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q6MR96 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 184857 | 185081 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
2 | 2346066 | 2346290 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
3 | 2168984 | 2169220 | + | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
4 | 9042852 | 9043067 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
5 | 3752659 | 3752874 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
6 | 706804 | 706986 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
7 | 2142425 | 2142634 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
8 | 3172625 | 3172849 | + | NZ_CP051183.1 | Bermanella marisrubri |
9 | 3514716 | 3514901 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
10 | 2104130 | 2104363 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
11 | 1313056 | 1313238 | - | NZ_AP012273.1 | Thiolapillus brandeum |
12 | 3489994 | 3490176 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
13 | 2242854 | 2243036 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
14 | 769393 | 769638 | - | NZ_CP013189.1 | Pseudohongiella spirulinae |
15 | 1432904 | 1433125 | + | NZ_CP021376.1 | Oceanisphaera avium |
16 | 2473809 | 2473994 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
17 | 1071273 | 1071530 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
18 | 3324064 | 3324246 | - | NZ_AP023213.1 | Citrifermentans bremense |
19 | 1453187 | 1453369 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
20 | 871581 | 871820 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
21 | 3200899 | 3201105 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
22 | 3749508 | 3749717 | + | NZ_CP028897.1 | Dongshaea marina |
23 | 5984465 | 5984650 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
24 | 2719199 | 2719384 | - | NZ_CP072793.1 | Thiothrix unzii |
25 | 745715 | 745912 | - | NZ_CP019650.1 | Microbulbifer agarilyticus |
26 | 4235898 | 4236116 | - | NZ_CP012661.1 | Defluviimonas alba |
27 | 2019424 | 2019606 | - | NZ_CP053627.1 | Xylella taiwanensis |
28 | 604347 | 604538 | + | NZ_CP027563.1 | Weissella confusa |
29 | 590293 | 590526 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
30 | 705156 | 705383 | + | NC_011899.1 | Halothermothrix orenii H 168 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00348.19 | 0.83 | 25 | 0 | same-strand | Polyprenyl synthetase |
2 | PF13292.8 | 0.67 | 20 | 962.5 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
3 | PF02779.26 | 0.67 | 20 | 962.5 | same-strand | Transketolase, pyrimidine binding domain |
4 | PF02780.22 | 0.67 | 20 | 962.5 | same-strand | Transketolase, C-terminal domain |