Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S18 |
NCBI Accession ID | BX842648.2 |
Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
Left | 193931 |
Right | 194200 |
Strand | - |
Nucleotide Sequence | ATGAAAAAGACAACTCGTAGCAAATACCGTCAGGAATTCTCTGGTGACCACGTATTCGATTACAAAGATCCAGCATCTTTGACTCGTTTCATCGGTGACGGTGGTAAAATCACTCCATCCAGAATCTCTAAACTCTCCGTTGCTCAACAAAAAAGAGTAGCTGCAGCAGTTAAGAAATCCCGTAACTTGGCTCTATTGCCATCTGGTTCTGACTCTTACGATACATTCCACAGAGCAGAAGCAATTTCTCCAGTTCCTTTCGAGATCTAA |
Sequence | MKKTTRSKYRQEFSGDHVFDYKDPASLTRFIGDGGKITPSRISKLSVAQQKRVAAAVKKSRNLALLPSGSDSYDTFHRAEAISPVPFEI |
Source of smORF | Swiss-Prot |
Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
Pubmed ID | 14752164 |
Domain | CDD:412341 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q6MPB8 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 889949 | 890218 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
2 | 767986 | 768282 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00830.21 | 1.0 | 2 | 140.0 | opposite-strand | Ribosomal L28 family |
2 | PF00795.24 | 1.0 | 2 | 1206.5 | opposite-strand | Carbon-nitrogen hydrolase |