Result : Q6MPB8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | BX842648.2 |
| Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left | 193931 |
| Right | 194200 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAGACAACTCGTAGCAAATACCGTCAGGAATTCTCTGGTGACCACGTATTCGATTACAAAGATCCAGCATCTTTGACTCGTTTCATCGGTGACGGTGGTAAAATCACTCCATCCAGAATCTCTAAACTCTCCGTTGCTCAACAAAAAAGAGTAGCTGCAGCAGTTAAGAAATCCCGTAACTTGGCTCTATTGCCATCTGGTTCTGACTCTTACGATACATTCCACAGAGCAGAAGCAATTTCTCCAGTTCCTTTCGAGATCTAA |
| Sequence | MKKTTRSKYRQEFSGDHVFDYKDPASLTRFIGDGGKITPSRISKLSVAQQKRVAAAVKKSRNLALLPSGSDSYDTFHRAEAISPVPFEI |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 14752164 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6MPB8 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 889949 | 890218 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 2 | 767986 | 768282 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005363.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00830.21 | 1.0 | 2 | 140.0 | opposite-strand | Ribosomal L28 family |
| 2 | PF00795.24 | 1.0 | 2 | 1206.5 | opposite-strand | Carbon-nitrogen hydrolase |
++ More..