| Protein name |
50S ribosomal protein L24 |
| NCBI Accession ID |
BX842648.2 |
| Organism |
Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left |
194697 |
| Right |
194957 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAAATTGAAAATCAAAAAAGGCGCGACAGTACAAGTTATCACAGGCTCTGACAAAGGTAAGAAGGGCACTGTTATCGCTGTAGACGCTAACGCTATGAAAATCCAAGTTCAAGGTGTGAAAGTACAAACACACTACGACAAAAAAGACGGTCTTTTGAAAAAAGAAGGCTTCATCGACTACTCCAACGTGAAGTTGGTTGAAGCTGCTTCTAAAGAGAAGAAGACTTCTAAAAAGGCTACTAAGTCTAAGTCCGCTTAG |
| Sequence |
MKLKIKKGATVQVITGSDKGKKGTVIAVDANAMKIQVQGVKVQTHYDKKDGLLKKEGFIDYSNVKLVEAASKEKKTSKKATKSKSA |
| Source of smORF |
Swiss-Prot |
| Function |
One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit. {ECO:0000255|HAMAP-Rule:MF_01326}.; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. {ECO:0000255|HAMAP-Rule:MF_01326}. |
| Pubmed ID |
14752164
|
| Domain |
CDD:412330 |
| Functional Category |
Ribosomal_protein |
| Uniprot ID |
Q6MPB7
|
| ORF Length (Amino Acid) |
86 |