Result : Q6MMQ7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | BX842650.1 |
| Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left | 102044 |
| Right | 102283 |
| Strand | + |
| Nucleotide Sequence | ATGGCTCGTGTAACCGTTGAAGATTGCTTGGAAAAAGTACCTAACAGATTTGCCCTTGTTTTGATGGTTGCAAAACGTGCGAAGCAACTTCTGAAAGGTGCAGAAGCGACAGTTTCCACTCGTAGCAACAAGTACATCGTAAGCTCCCTGCGTGAAGTTGCGATGGGCAACGTGGGCTACCAGGACAGCCTGGATGCAAACGAAGCTATCCGTCAGATCGAAAAGGATCTGAACAAGTAA |
| Sequence | MARVTVEDCLEKVPNRFALVLMVAKRAKQLLKGAEATVSTRSNKYIVSSLREVAMGNVGYQDSLDANEAIRQIEKDLNK |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 14752164 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q6MMQ7 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1494075 | 1494314 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 2 | 1560829 | 1561068 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
| 3 | 3044513 | 3044758 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 4 | 10318436 | 10318675 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 5 | 10130794 | 10131036 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 6 | 7085601 | 7085843 | - | NZ_CP022163.1 | Melittangium boletus DSM 14713 |
| 7 | 567442 | 567642 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 8 | 2333555 | 2333791 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 9 | 6968542 | 6968781 | + | NC_020126.1 | Myxococcus stipitatus DSM 14675 |
| 10 | 9616049 | 9616288 | + | NZ_CP016211.1 | Minicystis rosea |
| 11 | 1676638 | 1676844 | + | NZ_CP013816.1 | Piscirickettsia salmonis |
| 12 | 6038707 | 6038943 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 13 | 6123084 | 6123320 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 14 | 1647302 | 1647508 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 15 | 3058629 | 3058868 | - | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 16 | 101279 | 101539 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
| 17 | 2763497 | 2763709 | - | NZ_CP017715.1 | Marinobacter salinus |
| 18 | 2364257 | 2364481 | + | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 19 | 771253 | 771513 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 20 | 1841721 | 1841963 | - | NC_015572.1 | Methylomonas methanica MC09 |
| 21 | 3421175 | 3421417 | + | NZ_CP012333.1 | Labilithrix luteola |
| 22 | 2673719 | 2673943 | + | NZ_AP021889.1 | Thiosulfatimonas sediminis |
| 23 | 2321722 | 2321946 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 24 | 63279 | 63542 | - | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 25 | 231033 | 231254 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 26 | 2965301 | 2965522 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 27 | 1159661 | 1159921 | + | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 28 | 2260487 | 2260690 | - | NZ_CP013742.1 | Legionella pneumophila |
| 29 | 2463733 | 2463939 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 30 | 2572243 | 2572446 | - | NZ_CP016397.1 | Legionella clemsonensis |
| 31 | 1339850 | 1340071 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
++ More..