Result : Q6MMK4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | BX842650.1 |
| Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left | 170302 |
| Right | 170493 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATGCGCACTCACTCTGGCGCGAAGAAGCGTTTGAAAGTTCTTTCAAGCGGTAAAGTTAAGAAAAAAAGCACTCGCATGCGTCACTTGAACTCTCACATGAGCTCTAAGACGAAAAGACAACTAGGCAAAACATCATACGTTGAAGACGCGAACATGCTTCAAGTTCGTCGTTGTTTGGTATTCTAG |
| Sequence | MKMRTHSGAKKRLKVLSSGKVKKKSTRMRHLNSHMSSKTKRQLGKTSYVEDANMLQVRRCLVF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 14752164 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6MMK4 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1562333 | 1562524 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 2 | 1524146 | 1524331 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005363.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00707.24 | 1.0 | 2 | 6381.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 2 | PF00453.20 | 1.0 | 2 | 39.5 | same-strand | Ribosomal protein L20 |
| 3 | PF00368.20 | 1.0 | 2 | 1510.5 | same-strand | Hydroxymethylglutaryl-coenzyme A reductase |
++ More..