Result : Q6MLJ4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | BX842651.1 |
| Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left | 185147 |
| Right | 185332 |
| Strand | - |
| Nucleotide Sequence | ATGCCAACTCCTAAGAAGAAAACATCCCGCTCCAAGCGTGACATGCGCCGCTCTCACGACGGTCTTACTGCTCCAGCTATCGCTGTAGAAAAAAAGACTGGTGAACTTGTTCGCCCTCACCGCGCACACAAAGGTGCTGACGGTGCTTTGTACTACAAAGGCAAACAAATCAGCGCAGCGAAGTAA |
| Sequence | MPTPKKKTSRSKRDMRRSHDGLTAPAIAVEKKTGELVRPHRAHKGADGALYYKGKQISAAK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 14752164 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6MLJ4 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1926851 | 1927036 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 2 | 1342450 | 1342641 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
| 3 | 2770782 | 2770952 | + | NZ_CP041660.1 | Catenovulum sediminis |
| 4 | 3716261 | 3716452 | - | NZ_CP030848.1 | Sphingobacterium hotanense |
| 5 | 3926996 | 3927187 | + | NC_015177.1 | Pseudopedobacter saltans DSM 12145 |
| 6 | 681086 | 681277 | - | NZ_LR590470.1 | Sphingobacterium daejeonense |
| 7 | 10797 | 10976 | + | NZ_CP070273.1 | Marinomonas foliarum |
| 8 | 2304245 | 2304424 | - | NZ_CP061081.1 | Marinomonas arctica |
| 9 | 2024242 | 2024421 | - | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 10 | 671865 | 672041 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 11 | 2602597 | 2602788 | - | NC_018010.1 | Belliella baltica DSM 15883 |
| 12 | 1670019 | 1670201 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 13 | 2126130 | 2126312 | + | NZ_CP015839.1 | Marinobacterium aestuarii |
| 14 | 2025574 | 2025753 | + | NZ_CP054301.1 | Marinomonas primoryensis |
| 15 | 402507 | 402686 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 16 | 204727 | 204918 | + | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 17 | 203188 | 203379 | + | NZ_CP040106.1 | Echinicola rosea |
| 18 | 900608 | 900790 | - | NZ_CP012362.1 | Oblitimonas alkaliphila |
| 19 | 1984837 | 1985028 | + | NZ_CP030041.1 | Echinicola strongylocentroti |
| 20 | 3830466 | 3830657 | - | NC_017770.1 | Solitalea canadensis DSM 3403 |
| 21 | 761270 | 761461 | + | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 22 | 1123565 | 1123756 | + | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 23 | 1804610 | 1804804 | - | NZ_LN614830.1 | Tatlockia micdadei |
| 24 | 819894 | 820076 | + | NZ_CP071057.1 | Marinicauda algicola |
| 25 | 1185701 | 1185892 | + | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 26 | 2503337 | 2503513 | + | NZ_CP020083.1 | Blastomonas fulva |
| 27 | 1525619 | 1525783 | + | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 28 | 4796897 | 4797082 | + | NZ_CP030265.1 | Skermanella pratensis |
| 29 | 3020453 | 3020635 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 30 | 2232636 | 2232818 | + | NZ_CP042906.1 | Hypericibacter terrae |
| 31 | 196050 | 196244 | - | NZ_CP047897.1 | Nibribacter ruber |
| 32 | 3720902 | 3721084 | - | NZ_CP061799.1 | Desulfonema limicola |
| 33 | 909719 | 909895 | + | NZ_CP040602.1 | Thiomicrorhabdus sediminis |
| 34 | 3566277 | 3566456 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 35 | 1356695 | 1356868 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 36 | 652334 | 652516 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 37 | 3138037 | 3138222 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
| 38 | 699778 | 699957 | - | NZ_CP022745.1 | Sphingobium xenophagum |
| 39 | 996788 | 996970 | + | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 40 | 1300246 | 1300422 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 41 | 61851 | 62021 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 42 | 2371068 | 2371250 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 43 | 470854 | 471024 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 44 | 882959 | 883129 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 45 | 1621050 | 1621220 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 46 | 2301649 | 2301819 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 47 | 2347994 | 2348164 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 48 | 1789037 | 1789207 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 49 | 2175384 | 2175554 | - | NZ_LR134167.1 | Avibacterium volantium |
| 50 | 1305987 | 1306157 | + | NZ_CP028926.1 | Pasteurella multocida |
| 51 | 1812741 | 1812911 | - | NZ_CP016604.1 | Otariodibacter oris |
| 52 | 1444376 | 1444546 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 53 | 1754625 | 1754816 | + | NC_013861.1 | Legionella longbeachae NSW150 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP041660.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08541.12 | 0.77 | 41 | 1069 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 2 | PF08545.12 | 0.77 | 41 | 1069 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 3 | PF02620.19 | 0.85 | 45 | 19 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 4 | PF02504.17 | 0.75 | 40 | 22.0 | same-strand | Fatty acid synthesis protein |
++ More..