Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | BX842652.1 |
Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
Left | 8665 |
Right | 8904 |
Strand | + |
Nucleotide Sequence | ATGGGTGAGTTTAGCCTTACGCACATTCTGCTTCTTGCAGTTATCTTTTTGATCTTCTTCGGTCCAAGCCGTCTGCCACAATTGGGTCAGTCCATGGGTAAAGCCATCCGTGGTTTCAAACAAGGCCTGAATGAAATCGACGTTGATGCCAAAGACATTCACGACAACCAGCAAGTTTCCCATCAGAATAAACAGTCTATGGGTCAAACTCAGAAACAAGGCGAAAACCAAAACTCCTAA |
Sequence | MGEFSLTHILLLAVIFLIFFGPSRLPQLGQSMGKAIRGFKQGLNEIDVDAKDIHDNQQVSHQNKQSMGQTQKQGENQNS |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | 14752164 |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | Q6ML26 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2096480 | 2096719 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
2 | 1426622 | 1426834 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00496.24 | 1.0 | 2 | 3062.5 | same-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
2 | PF00528.24 | 1.0 | 2 | 1452.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
3 | PF03009.19 | 1.0 | 2 | 658.0 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
4 | PF01272.21 | 1.0 | 2 | 3449.5 | opposite-strand | Transcription elongation factor, GreA/GreB, C-term |
5 | PF03449.17 | 1.0 | 2 | 3449.5 | opposite-strand | Transcription elongation factor, N-terminal |