Result : Q6ML26
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | BX842652.1 |
| Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left | 8665 |
| Right | 8904 |
| Strand | + |
| Nucleotide Sequence | ATGGGTGAGTTTAGCCTTACGCACATTCTGCTTCTTGCAGTTATCTTTTTGATCTTCTTCGGTCCAAGCCGTCTGCCACAATTGGGTCAGTCCATGGGTAAAGCCATCCGTGGTTTCAAACAAGGCCTGAATGAAATCGACGTTGATGCCAAAGACATTCACGACAACCAGCAAGTTTCCCATCAGAATAAACAGTCTATGGGTCAAACTCAGAAACAAGGCGAAAACCAAAACTCCTAA |
| Sequence | MGEFSLTHILLLAVIFLIFFGPSRLPQLGQSMGKAIRGFKQGLNEIDVDAKDIHDNQQVSHQNKQSMGQTQKQGENQNS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 14752164 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q6ML26 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2096480 | 2096719 | + | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 2 | 1426622 | 1426834 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005363.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00496.24 | 1.0 | 2 | 3062.5 | same-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
| 2 | PF00528.24 | 1.0 | 2 | 1452.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 3 | PF03009.19 | 1.0 | 2 | 658.0 | opposite-strand | Glycerophosphoryl diester phosphodiesterase family |
| 4 | PF01272.21 | 1.0 | 2 | 3449.5 | opposite-strand | Transcription elongation factor, GreA/GreB, C-term |
| 5 | PF03449.17 | 1.0 | 2 | 3449.5 | opposite-strand | Transcription elongation factor, N-terminal |
++ More..