Result : Q6MJ30
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L30 |
| NCBI Accession ID | BX842654.1 |
| Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
| Left | 84043 |
| Right | 84237 |
| Strand | - |
| Nucleotide Sequence | GTGGCAAAAATGGCTAAAACATTCGTAGTAACTTTGAAAAGATCAACTATCAAATGCACGCAGGATCAAAAGGATGCAGTTCGTGTCCTTGGTCTTAAGAAAATTCGCCAAACTGTTGAGGTGAAAGATTCTGCTGCGGCACGTGGTAATATCATGAAAGTTCAACATCTTATTGATGTTGAAGTTAAGGGGTAA |
| Sequence | MAKMAKTFVVTLKRSTIKCTQDQKDAVRVLGLKKIRQTVEVKDSAAARGNIMKVQHLIDVEVKG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00203. Profile Description: N/A. This family includes prokaryotic L30 and eukaryotic L7. |
| Pubmed ID | 14752164 |
| Domain | CDD:412218 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6MJ30 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 108
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2865542 | 2865736 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
| 2 | 1921330 | 1921515 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
| 3 | 2330339 | 2330527 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 4 | 6336798 | 6336989 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 5 | 2570480 | 2570662 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 6 | 1308004 | 1308186 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 7 | 1295066 | 1295248 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 8 | 149576 | 149758 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 9 | 1754743 | 1754919 | - | NZ_LR134484.1 | Gemella haemolysans |
| 10 | 186526 | 186702 | - | NZ_CP046314.1 | Gemella morbillorum |
| 11 | 2348023 | 2348202 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 12 | 2893968 | 2894165 | - | NZ_AP018437.1 | Pelolinea submarina |
| 13 | 375783 | 375968 | - | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 14 | 426981 | 427148 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 15 | 1748359 | 1748541 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 16 | 48713 | 48895 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 17 | 683341 | 683559 | + | NZ_CP036250.1 | Egicoccus halophilus |
| 18 | 155208 | 155390 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 19 | 258444 | 258626 | + | NZ_CP053989.1 | Niallia circulans |
| 20 | 55719 | 55904 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 21 | 1484503 | 1484685 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 22 | 117153 | 117335 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 23 | 1401569 | 1401751 | - | NZ_CP043404.1 | Bacillus safensis |
| 24 | 1201845 | 1202027 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 25 | 281413 | 281589 | - | NZ_CP026363.1 | Brevibacillus agri |
| 26 | 44229 | 44417 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 27 | 3272629 | 3272817 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 28 | 475310 | 475498 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 29 | 1938123 | 1938305 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 30 | 1418379 | 1418561 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 31 | 128127 | 128315 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 32 | 155756 | 155938 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 33 | 4743980 | 4744162 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 34 | 2829833 | 2830021 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 35 | 2259992 | 2260180 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 36 | 394581 | 394769 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 37 | 136181 | 136369 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 38 | 136966 | 137154 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 39 | 141985 | 142164 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 40 | 150452 | 150634 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 41 | 3786525 | 3786704 | - | NZ_CP011937.1 | Bacillus velezensis |
| 42 | 279862 | 280041 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 43 | 143815 | 143994 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 44 | 144837 | 145016 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 45 | 143576 | 143755 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 46 | 143701 | 143880 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 47 | 113595 | 113774 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 48 | 1865648 | 1865827 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 49 | 143875 | 144054 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 50 | 275387 | 275572 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 51 | 2277539 | 2277706 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 52 | 174465 | 174644 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 53 | 5773845 | 5774003 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 54 | 156871 | 157056 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 55 | 309793 | 309960 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 56 | 1987262 | 1987441 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 57 | 644800 | 644979 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 58 | 179141 | 179320 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 59 | 3785533 | 3785721 | - | NZ_CP020931.1 | Marinobacter salarius |
| 60 | 392334 | 392513 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 61 | 499940 | 500119 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 62 | 864379 | 864558 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 63 | 1956883 | 1957044 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 64 | 115255 | 115434 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 65 | 188691 | 188873 | + | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 66 | 2504092 | 2504274 | - | NZ_CP068055.1 | Sutterella wadsworthensis |
| 67 | 2670076 | 2670264 | - | NZ_CP017715.1 | Marinobacter salinus |
| 68 | 983702 | 983878 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 69 | 1763148 | 1763327 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 70 | 1441967 | 1442143 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 71 | 3280003 | 3280188 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
| 72 | 2814396 | 2814566 | - | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 73 | 6081776 | 6081946 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 74 | 2795191 | 2795373 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 75 | 5541635 | 5541799 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 76 | 654933 | 655100 | + | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 77 | 3615911 | 3616093 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 78 | 1104896 | 1105081 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 79 | 632761 | 632928 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 80 | 4493951 | 4494130 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 81 | 4506662 | 4506847 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 82 | 3573888 | 3574073 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 83 | 435354 | 435539 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 84 | 1504645 | 1504806 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 85 | 83453 | 83632 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 86 | 6407618 | 6407779 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 87 | 2670020 | 2670187 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 88 | 2055487 | 2055660 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 89 | 1138818 | 1138997 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 90 | 1148201 | 1148368 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 91 | 3696207 | 3696389 | + | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 92 | 70590 | 70769 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 93 | 77697 | 77876 | + | NZ_CP065211.1 | Enterococcus lactis |
| 94 | 74995 | 75174 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 95 | 2969290 | 2969469 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 96 | 3976474 | 3976653 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 97 | 1674853 | 1675017 | + | NZ_LR134352.1 | Nocardia asteroides |
| 98 | 1994621 | 1994800 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 99 | 2719431 | 2719613 | - | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 100 | 581987 | 582166 | - | NZ_CP023011.2 | Enterococcus hirae |
| 101 | 3165955 | 3166134 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 102 | 852959 | 853123 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 103 | 221509 | 221694 | - | NZ_CP034437.1 | Paenibacillus albus |
| 104 | 754643 | 754831 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 105 | 2733883 | 2734062 | - | NZ_CP034549.1 | Nonlabens ponticola |
| 106 | 903175 | 903354 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 107 | 921317 | 921499 | - | NZ_CP016359.1 | Gramella flava JLT2011 |
| 108 | 1907094 | 1907264 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005363.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00406.24 | 0.82 | 89 | 1827 | same-strand | Adenylate kinase |
| 2 | PF13207.8 | 0.82 | 89 | 1827 | same-strand | AAA domain |
| 3 | PF05191.16 | 0.67 | 72 | 1823.0 | same-strand | Adenylate kinase, active site lid |
| 4 | PF13671.8 | 0.69 | 75 | 1824 | same-strand | AAA domain |
| 5 | PF00344.22 | 0.96 | 104 | 473.0 | same-strand | SecY |
| 6 | PF00828.21 | 1.0 | 108 | 25.0 | same-strand | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A |
| 7 | PF03719.17 | 1.0 | 108 | 14.0 | same-strand | Ribosomal protein S5, C-terminal domain |
| 8 | PF00333.22 | 1.0 | 108 | 14.0 | same-strand | Ribosomal protein S5, N-terminal domain |
| 9 | PF00861.24 | 1.0 | 108 | 539.0 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
| 10 | PF00347.25 | 1.0 | 108 | 933.5 | same-strand | Ribosomal protein L6 |
| 11 | PF00410.21 | 1.0 | 108 | 1503.0 | same-strand | Ribosomal protein S8 |
| 12 | PF00253.23 | 0.88 | 95 | 1933 | same-strand | Ribosomal protein S14p/S29e |
++ More..