Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L23 |
NCBI Accession ID | BX842654.1 |
Organism | Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) |
Left | 90290 |
Right | 90568 |
Strand | - |
Nucleotide Sequence | ATGAAACAAGTAATTAAAGCCCCTCTCATTACTGAGAAAAATACTTATCACAACGCTGCTGGCGTATACGTGTTCGAAGTGGACTTGAAGTCCTCTAAAACAGAAGTAAAAGCCGCTGTTGAGAAAAACTTTAAAGTTAAAGTTGATAGCGTAAGAACTAGCGTCTGCCGCGGTCACTCTAAGCAAACTAAATTCGGTCTAACCAAGGTCGCTTACTGGAAGAAAGCTTACGTTAAGCTTGCTGAAGGCGAGAAGATCGCTCTTTTTGAGGGAGTATAA |
Sequence | MKQVIKAPLITEKNTYHNAAGVYVFEVDLKSSKTEVKAAVEKNFKVKVDSVRTSVCRGHSKQTKFGLTKVAYWKKAYVKLAEGEKIALFEGV |
Source of smORF | Swiss-Prot |
Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
Pubmed ID | 14752164 |
Domain | CDD:412311 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q6MJ16 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2871789 | 2872067 | - | NC_005363.1 | Bdellovibrio bacteriovorus HD100 |
2 | 1927566 | 1927844 | - | NC_020813.1 | Bdellovibrio exovorus JSS |
3 | 3425222 | 3425464 | - | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
4 | 1321309 | 1321599 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00252.20 | 1.0 | 4 | 2124.0 | same-strand | Ribosomal protein L16p/L10e |
2 | PF00189.22 | 1.0 | 4 | 1474.5 | same-strand | Ribosomal protein S3, C-terminal domain |
3 | PF07650.19 | 1.0 | 4 | 1474.5 | same-strand | KH domain |
4 | PF00237.21 | 1.0 | 4 | 1136.0 | same-strand | Ribosomal protein L22p/L17e |
5 | PF00203.23 | 1.0 | 4 | 837.5 | same-strand | Ribosomal protein S19 |
6 | PF03947.20 | 1.0 | 4 | 3.5 | same-strand | Ribosomal Proteins L2, C-terminal domain |
7 | PF00181.25 | 1.0 | 4 | 3.5 | same-strand | Ribosomal Proteins L2, RNA binding domain |
8 | PF00573.24 | 1.0 | 4 | 8.5 | same-strand | Ribosomal protein L4/L1 family |
9 | PF00338.24 | 1.0 | 4 | 1318.5 | same-strand | Ribosomal protein S10p/S20e |
10 | PF00009.29 | 1.0 | 4 | 1852 | same-strand | Elongation factor Tu GTP binding domain |
11 | PF14492.8 | 1.0 | 4 | 1848.5 | same-strand | Elongation Factor G, domain III |
12 | PF00679.26 | 1.0 | 4 | 1848.5 | same-strand | Elongation factor G C-terminus |
13 | PF03764.20 | 1.0 | 4 | 1848.5 | same-strand | Elongation factor G, domain IV |
14 | PF03144.27 | 1.0 | 4 | 1852 | same-strand | Elongation factor Tu domain 2 |
15 | PF00177.23 | 0.75 | 3 | 3943 | same-strand | Ribosomal protein S7p/S5e |
16 | PF01926.25 | 0.75 | 3 | 1943.0 | same-strand | 50S ribosome-binding GTPase |