Result : A8YUJ6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000517.1 |
| Organism | Lactobacillus helveticus (strain DPC 4571) |
| Left | 791045 |
| Right | 791278 |
| Strand | + |
| Nucleotide Sequence | ATGTCATTTATGTCAGAAGCTTTTAAATACCTTGCTGCATCCATCGCAGCTGGTTTAGCAGCTTTAGCTGCTGCATTGGGTAACGGTAAAGTTATTTCAAAAACTCTTGAAGGTATGGCTCGTCAACCTGAAAGTGCAGATAACTTAAGAGCAACAATGTTTATCGGTGTTGGTTTGATCGAAGCCGTTCCTATTTTAGCTATCGTTGTTGCCTTCTTGATTCTTTTCCTTTAA |
| Sequence | MSFMSEAFKYLAASIAAGLAALAAALGNGKVISKTLEGMARQPESADNLRATMFIGVGLIEAVPILAIVVAFLILFL |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 17993529 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | A8YUJ6 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 112
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 526271 | 526504 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 2 | 745608 | 745832 | + | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 3 | 804662 | 804886 | + | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 4 | 757182 | 757415 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 5 | 652267 | 652491 | + | NZ_CP029476.1 | Lactobacillus apis |
| 6 | 1404489 | 1404713 | - | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 7 | 1081074 | 1081298 | - | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 8 | 846700 | 846924 | - | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 9 | 1473191 | 1473403 | - | NZ_CP059829.1 | Lactobacillus ultunensis |
| 10 | 1230266 | 1230487 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 11 | 832004 | 832225 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 12 | 1032972 | 1033184 | + | NZ_CP060720.1 | Vagococcus carniphilus |
| 13 | 183268 | 183480 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 14 | 1243903 | 1244115 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 15 | 882658 | 882870 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 16 | 776821 | 777033 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 17 | 678812 | 679024 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 18 | 3061902 | 3062126 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 19 | 1242514 | 1242726 | - | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 20 | 1104149 | 1104361 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 21 | 1070784 | 1070996 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 22 | 1283742 | 1283954 | - | NZ_AP018549.1 | Lactobacillus paragasseri |
| 23 | 1846748 | 1846960 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 24 | 37198 | 37410 | - | NZ_CP027770.1 | Staphylococcus felis |
| 25 | 505875 | 506087 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 26 | 708338 | 708550 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 27 | 870320 | 870532 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 28 | 1012431 | 1012643 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 29 | 2074180 | 2074392 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 30 | 51585 | 51797 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 31 | 809348 | 809560 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 32 | 891148 | 891384 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 33 | 1614669 | 1614881 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 34 | 1665233 | 1665445 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 35 | 1676101 | 1676313 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 36 | 2365379 | 2365591 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 37 | 240037 | 240252 | + | NZ_CP019573.1 | Abyssicoccus albus |
| 38 | 911851 | 912087 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 39 | 1607928 | 1608140 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 40 | 250698 | 250919 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 41 | 956564 | 956776 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 42 | 1325348 | 1325560 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 43 | 897916 | 898128 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 44 | 105949 | 106161 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 45 | 819890 | 820102 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 46 | 860725 | 860937 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 47 | 609125 | 609337 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 48 | 2041914 | 2042126 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 49 | 2128112 | 2128324 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 50 | 2172982 | 2173194 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 51 | 4893383 | 4893595 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 52 | 839239 | 839445 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 53 | 1873328 | 1873534 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 54 | 896533 | 896739 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 55 | 939239 | 939451 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 56 | 1787273 | 1787485 | - | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 57 | 2405833 | 2406045 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 58 | 1727052 | 1727279 | - | NZ_LT906470.1 | Veillonella rodentium |
| 59 | 3889113 | 3889331 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 60 | 108283 | 108501 | + | NZ_CP040336.1 | Bacillus luti |
| 61 | 5043350 | 5043568 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 62 | 5064199 | 5064417 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 63 | 5229627 | 5229845 | - | NC_011725.1 | Bacillus cereus B4264 |
| 64 | 5267343 | 5267561 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 65 | 6363324 | 6363548 | - | NZ_AP019400.1 | Cohnella abietis |
| 66 | 1007331 | 1007543 | + | NZ_CP026363.1 | Brevibacillus agri |
| 67 | 1405277 | 1405480 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 68 | 1668694 | 1668906 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 69 | 4349514 | 4349720 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 70 | 942895 | 943107 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 71 | 4224668 | 4224892 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 72 | 5297826 | 5298014 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 73 | 1403822 | 1404028 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 74 | 6645154 | 6645360 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 75 | 1375890 | 1376096 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 76 | 7365336 | 7365545 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 77 | 1858784 | 1858996 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 78 | 3824957 | 3825172 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 79 | 440631 | 440855 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 80 | 1761820 | 1762044 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 81 | 2521205 | 2521423 | - | NZ_LT906444.1 | Listeria welshimeri |
| 82 | 2400151 | 2400399 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 83 | 528500 | 528718 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 84 | 2470173 | 2470385 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 85 | 2506195 | 2506413 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 86 | 2635953 | 2636171 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 87 | 2611192 | 2611410 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 88 | 3420997 | 3421203 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 89 | 2499745 | 2499963 | - | NZ_LR134483.1 | Listeria grayi |
| 90 | 6496487 | 6496699 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 91 | 192587 | 192808 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 92 | 2284398 | 2284613 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 93 | 4903689 | 4903877 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 94 | 1360982 | 1361200 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 95 | 375883 | 376074 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 96 | 1521948 | 1522160 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 97 | 7631822 | 7632025 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 98 | 1491542 | 1491751 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 99 | 3871792 | 3871992 | - | NZ_CP033433.1 | Cohnella candidum |
| 100 | 5966374 | 5966577 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 101 | 6393183 | 6393395 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 102 | 3734527 | 3734730 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 103 | 3404617 | 3404829 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 104 | 2566865 | 2567077 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 105 | 413427 | 413639 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 106 | 2535035 | 2535247 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 107 | 4026839 | 4027048 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 108 | 1669251 | 1669478 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 109 | 1725074 | 1725301 | - | NZ_LR134375.1 | Veillonella dispar |
| 110 | 1785729 | 1785956 | - | NZ_LR778174.1 | Veillonella parvula |
| 111 | 2825416 | 2825631 | - | NC_006512.1 | Idiomarina loihiensis L2TR |
| 112 | 3088268 | 3088489 | - | NC_008260.1 | Alcanivorax borkumensis SK2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014925.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14681.8 | 0.79 | 89 | 2469 | same-strand | Uracil phosphoribosyltransferase |
| 2 | PF00119.22 | 1.0 | 112 | 44.0 | same-strand | ATP synthase A chain |
| 3 | PF00430.20 | 0.99 | 111 | 98 | same-strand | ATP synthase B/B' CF(0) |
| 4 | PF00213.20 | 0.99 | 111 | 599 | same-strand | ATP synthase delta (OSCP) subunit |
| 5 | PF00006.27 | 1.0 | 112 | 1651 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 6 | PF00306.29 | 1.0 | 112 | 1174.5 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 7 | PF02874.25 | 1.0 | 112 | 1651 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 8 | PF00231.21 | 1.0 | 112 | 2730.0 | same-strand | ATP synthase |
| 9 | PF02350.21 | 0.61 | 68 | 1628.0 | same-strand | UDP-N-acetylglucosamine 2-epimerase |
| 10 | PF03899.17 | 0.7 | 78 | 801.5 | same-strand | ATP synthase I chain |
++ More..