Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S21 |
NCBI Accession ID | BX908798.2 |
Organism | Protochlamydia amoebophila (strain UWE25) |
Left | 600695 |
Right | 600874 |
Strand | + |
Nucleotide Sequence | ATGTCACTTGTAAAAGTCCGTATAGGCGACTCAATAGATAAAGCTCTCCGTGCCTTGAAGAAACGTCTCGATAAAGAAGGAGTTATGAAGTCTGTAAAAGCACATCGTTTTTATTCTAAACCTTCTATCAAAAAACGTGCTAAATCTAAAGCTGCTTTAAAATATAAGAAACAACGTTAA |
Sequence | MSLVKVRIGDSIDKALRALKKRLDKEGVMKSVKAHRFYSKPSIKKRAKSKAALKYKKQR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
Pubmed ID | 15073324 |
Domain | CDD:412427 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q6ME08 |
ORF Length (Amino Acid) | 59 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2686055 | 2686234 | - | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
2 | 1523607 | 1523780 | - | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
3 | 2140348 | 2140533 | + | NC_015713.1 | Simkania negevensis Z |
4 | 437602 | 437778 | - | NZ_LS398098.1 | Chlamydia suis |
5 | 390774 | 390950 | - | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
6 | 744859 | 745035 | - | NC_002620.2 | Chlamydia muridarum str. Nigg |
7 | 2537326 | 2537496 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01556.20 | 0.86 | 6 | 69.0 | same-strand | DnaJ C terminal domain |
2 | PF00226.33 | 0.86 | 6 | 69.0 | same-strand | DnaJ domain |
3 | PF00684.21 | 0.86 | 6 | 69.0 | same-strand | DnaJ central domain |
4 | PF05362.15 | 0.71 | 5 | 1139 | opposite-strand | Lon protease (S16) C-terminal proteolytic domain |
5 | PF02190.18 | 0.71 | 5 | 1139 | opposite-strand | ATP-dependent protease La (LON) substrate-binding domain |
6 | PF00004.31 | 0.71 | 5 | 1139 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
7 | PF07728.16 | 0.71 | 5 | 1139 | opposite-strand | AAA domain (dynein-related subfamily) |
8 | PF13541.8 | 0.71 | 5 | 1139 | opposite-strand | Subunit ChlI of Mg-chelatase |