Result : Q6ME08
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 |
| NCBI Accession ID | BX908798.2 |
| Organism | Protochlamydia amoebophila (strain UWE25) |
| Left | 600695 |
| Right | 600874 |
| Strand | + |
| Nucleotide Sequence | ATGTCACTTGTAAAAGTCCGTATAGGCGACTCAATAGATAAAGCTCTCCGTGCCTTGAAGAAACGTCTCGATAAAGAAGGAGTTATGAAGTCTGTAAAAGCACATCGTTTTTATTCTAAACCTTCTATCAAAAAACGTGCTAAATCTAAAGCTGCTTTAAAATATAAGAAACAACGTTAA |
| Sequence | MSLVKVRIGDSIDKALRALKKRLDKEGVMKSVKAHRFYSKPSIKKRAKSKAALKYKKQR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 15073324 |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6ME08 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2686055 | 2686234 | - | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 2 | 1523607 | 1523780 | - | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 3 | 2140348 | 2140533 | + | NC_015713.1 | Simkania negevensis Z |
| 4 | 437602 | 437778 | - | NZ_LS398098.1 | Chlamydia suis |
| 5 | 390774 | 390950 | - | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 6 | 744859 | 745035 | - | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 7 | 2537326 | 2537496 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014225.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01556.20 | 0.86 | 6 | 69.0 | same-strand | DnaJ C terminal domain |
| 2 | PF00226.33 | 0.86 | 6 | 69.0 | same-strand | DnaJ domain |
| 3 | PF00684.21 | 0.86 | 6 | 69.0 | same-strand | DnaJ central domain |
| 4 | PF05362.15 | 0.71 | 5 | 1139 | opposite-strand | Lon protease (S16) C-terminal proteolytic domain |
| 5 | PF02190.18 | 0.71 | 5 | 1139 | opposite-strand | ATP-dependent protease La (LON) substrate-binding domain |
| 6 | PF00004.31 | 0.71 | 5 | 1139 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF07728.16 | 0.71 | 5 | 1139 | opposite-strand | AAA domain (dynein-related subfamily) |
| 8 | PF13541.8 | 0.71 | 5 | 1139 | opposite-strand | Subunit ChlI of Mg-chelatase |
++ More..