Result : Q6MDZ8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein pc0477 |
| NCBI Accession ID | BX908798.2 |
| Organism | Protochlamydia amoebophila (strain UWE25) |
| Left | 612933 |
| Right | 613229 |
| Strand | - |
| Nucleotide Sequence | ATGGGAACTGGTTTTTCTAAAAAAAAGAAAGAAGCTCGACTAATACAACAGCAAATGAGTTTGGTTCAAAATGAATTACAAAATCTTGAAGTGGTAGGTGTCGCAGGAAGTGGTTTAGTGACAATCACCTTGACTGGCGATGGAGAGATGAAACAAGTTAAAATCAAACCTGAATGTGTCGACGTAGAAGATTTAGAAGGATTAGAGATGTTAATTCGTGCAGCTCATGCCGATGCTCATAAACGATTAAAAGAACAAAGCCCTCCCATTCCCGGATTCCCAGGATTCTTGGCTTAA |
| Sequence | MGTGFSKKKKEARLIQQQMSLVQNELQNLEVVGVAGSGLVTITLTGDGEMKQVKIKPECVDVEDLEGLEMLIRAAHADAHKRLKEQSPPIPGFPGFLA |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | 15073324 |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | Q6MDZ8 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 605962 | 606276 | - | NC_015713.1 | Simkania negevensis Z |
| 2 | 2639360 | 2639674 | + | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 3 | 1511813 | 1512052 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015702.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00381.21 | 1.0 | 3 | 2215 | opposite-strand | PTS HPr component phosphorylation site |
| 2 | PF02896.20 | 1.0 | 3 | 445 | opposite-strand | PEP-utilising enzyme, PEP-binding domain |
| 3 | PF05524.15 | 1.0 | 3 | 445 | opposite-strand | PEP-utilising enzyme, N-terminal |
| 4 | PF00391.25 | 1.0 | 3 | 445 | opposite-strand | PEP-utilising enzyme, mobile domain |
| 5 | PF13177.8 | 1.0 | 3 | 82 | same-strand | DNA polymerase III, delta subunit |
| 6 | PF00004.31 | 1.0 | 3 | 82 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 7 | PF12169.10 | 1.0 | 3 | 82 | same-strand | DNA polymerase III subunits gamma and tau domain III |
| 8 | PF13401.8 | 1.0 | 3 | 82 | same-strand | AAA domain |
| 9 | PF07698.13 | 0.67 | 2 | 3240.5 | opposite-strand | 7TM receptor with intracellular HD hydrolase |
| 10 | PF07697.13 | 0.67 | 2 | 3240.5 | opposite-strand | 7TM-HD extracellular |
| 11 | PF01966.24 | 0.67 | 2 | 3240.5 | opposite-strand | HD domain |
| 12 | PF07475.14 | 0.67 | 2 | 2251.0 | opposite-strand | HPr Serine kinase C-terminal domain |
| 13 | PF02603.18 | 0.67 | 2 | 2251.0 | opposite-strand | HPr Serine kinase N terminus |
| 14 | PF09346.12 | 0.67 | 2 | 3341.0 | opposite-strand | SMI1 / KNR4 family (SUKH-1) |
++ More..