Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | BX908798.2 |
Organism | Protochlamydia amoebophila (strain UWE25) |
Left | 782675 |
Right | 782953 |
Strand | - |
Nucleotide Sequence | GTGAATAATCCATCTGATCAAGAACCTACTGCTAGCTTTGAAACAGCTTTATGCCGCTTAGAAGAAATACTTGAAAAGATGAATAGCGGTACAGTAAGCCTTGATGAATCTCTTAAACTTTATGAAGAAGCTGATCAGTTAATAATAATTTGCAATAAACGATTAAATGATGCTGAACGAAAAATAGAGATTCTAGTCAAAAACCGTAGTGGTGAATTAACACTAGGAAACGACGACAAACCTATCATTCAAGATTTTAAGATCGCTTCAACCTCTTAA |
Sequence | MNNPSDQEPTASFETALCRLEEILEKMNSGTVSLDESLKLYEEADQLIIICNKRLNDAERKIEILVKNRSGELTLGNDDKPIIQDFKIASTS |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 15073324 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q6MDK5 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1110499 | 1110726 | + | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
2 | 1236909 | 1237157 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
3 | 926301 | 926585 | - | NC_015713.1 | Simkania negevensis Z |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13649.8 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
2 | PF08241.14 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
3 | PF13489.8 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
4 | PF08242.14 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
5 | PF02601.17 | 1.0 | 3 | -3 | same-strand | Exonuclease VII, large subunit |
6 | PF13742.8 | 1.0 | 3 | -3 | same-strand | OB-fold nucleic acid binding domain |
7 | PF01336.27 | 1.0 | 3 | -3 | same-strand | OB-fold nucleic acid binding domain |
8 | PF13292.8 | 0.67 | 2 | -8.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
9 | PF02780.22 | 0.67 | 2 | -8.0 | same-strand | Transketolase, C-terminal domain |
10 | PF02779.26 | 0.67 | 2 | -8.0 | same-strand | Transketolase, pyrimidine binding domain |
11 | PF20143.1 | 1.0 | 3 | 1873 | same-strand | ATP-NAD kinase C-terminal domain |
12 | PF01345.20 | 0.67 | 2 | 2918.0 | same-strand | Domain of unknown function DUF11 |
13 | PF03504.15 | 0.67 | 2 | 2918.0 | same-strand | Chlamydia cysteine-rich outer membrane protein 6 |
14 | PF01327.23 | 0.67 | 2 | 2572.0 | both-strands | Polypeptide deformylase |
15 | PF03840.16 | 0.67 | 2 | 2253.5 | opposite-strand | Preprotein translocase SecG subunit |
16 | PF00121.20 | 0.67 | 2 | 1486.5 | opposite-strand | Triosephosphate isomerase |