Result : Q6MDK5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | BX908798.2 |
| Organism | Protochlamydia amoebophila (strain UWE25) |
| Left | 782675 |
| Right | 782953 |
| Strand | - |
| Nucleotide Sequence | GTGAATAATCCATCTGATCAAGAACCTACTGCTAGCTTTGAAACAGCTTTATGCCGCTTAGAAGAAATACTTGAAAAGATGAATAGCGGTACAGTAAGCCTTGATGAATCTCTTAAACTTTATGAAGAAGCTGATCAGTTAATAATAATTTGCAATAAACGATTAAATGATGCTGAACGAAAAATAGAGATTCTAGTCAAAAACCGTAGTGGTGAATTAACACTAGGAAACGACGACAAACCTATCATTCAAGATTTTAAGATCGCTTCAACCTCTTAA |
| Sequence | MNNPSDQEPTASFETALCRLEEILEKMNSGTVSLDESLKLYEEADQLIIICNKRLNDAERKIEILVKNRSGELTLGNDDKPIIQDFKIASTS |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 15073324 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q6MDK5 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1110499 | 1110726 | + | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 2 | 1236909 | 1237157 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 3 | 926301 | 926585 | - | NC_015713.1 | Simkania negevensis Z |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015702.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13649.8 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
| 2 | PF08241.14 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
| 3 | PF13489.8 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
| 4 | PF08242.14 | 0.67 | 2 | 3692.5 | both-strands | Methyltransferase domain |
| 5 | PF02601.17 | 1.0 | 3 | -3 | same-strand | Exonuclease VII, large subunit |
| 6 | PF13742.8 | 1.0 | 3 | -3 | same-strand | OB-fold nucleic acid binding domain |
| 7 | PF01336.27 | 1.0 | 3 | -3 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF13292.8 | 0.67 | 2 | -8.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 9 | PF02780.22 | 0.67 | 2 | -8.0 | same-strand | Transketolase, C-terminal domain |
| 10 | PF02779.26 | 0.67 | 2 | -8.0 | same-strand | Transketolase, pyrimidine binding domain |
| 11 | PF20143.1 | 1.0 | 3 | 1873 | same-strand | ATP-NAD kinase C-terminal domain |
| 12 | PF01345.20 | 0.67 | 2 | 2918.0 | same-strand | Domain of unknown function DUF11 |
| 13 | PF03504.15 | 0.67 | 2 | 2918.0 | same-strand | Chlamydia cysteine-rich outer membrane protein 6 |
| 14 | PF01327.23 | 0.67 | 2 | 2572.0 | both-strands | Polypeptide deformylase |
| 15 | PF03840.16 | 0.67 | 2 | 2253.5 | opposite-strand | Preprotein translocase SecG subunit |
| 16 | PF00121.20 | 0.67 | 2 | 1486.5 | opposite-strand | Triosephosphate isomerase |
++ More..