Result : Q6MDF9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | BX908798.2 |
| Organism | Protochlamydia amoebophila (strain UWE25) |
| Left | 831896 |
| Right | 832171 |
| Strand | - |
| Nucleotide Sequence | ATGTCTAAAGTATGTCAAGTTACAGGTAGAAAACCTACACGTGGCTATAAATATGCCATTCGTGGTATTGCAAAGAAGAAAAAAGGAATTGGTCTTAAAGTGACAGGAAAAACAAAACGTCGCTTTCAACCGAATCTTTTTAAAAAAAGAATCTGGTTCGCAGAAGAAAATCGCTTTATTACTTTGAAGCTTTCTACCGCTGCTTTAAGAACTATTGATCGTCTCGGAGTCTTTGCTGTTGTTCGTAAAATGCGTGCAAATGGTCAATCTGTCTAA |
| Sequence | MSKVCQVTGRKPTRGYKYAIRGIAKKKKGIGLKVTGKTKRRFQPNLFKKRIWFAEENRFITLKLSTAALRTIDRLGVFAVVRKMRANGQSV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 15073324 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6MDF9 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1858429 | 1858704 | + | NC_015713.1 | Simkania negevensis Z |
| 2 | 784351 | 784608 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 3 | 420646 | 420915 | - | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 4 | 99565 | 99834 | - | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 5 | 99436 | 99705 | - | NZ_LS398098.1 | Chlamydia suis |
| 6 | 370359 | 370628 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 7 | 2055851 | 2056135 | - | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 8 | 513975 | 514244 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 9 | 650157 | 650426 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 10 | 513561 | 513830 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 11 | 894230 | 894499 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 12 | 484300 | 484569 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002620.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13091.8 | 0.83 | 10 | 1874.0 | same-strand | PLD-like domain |
| 2 | PF01977.18 | 0.75 | 9 | 31 | same-strand | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase |
| 3 | PF02446.19 | 0.75 | 9 | 164 | same-strand | 4-alpha-glucanotransferase |
| 4 | PF05932.15 | 0.75 | 9 | 1794 | same-strand | Tir chaperone protein (CesT) family |
| 5 | PF07201.13 | 0.75 | 9 | 2254 | same-strand | HrpJ-like domain |
| 6 | PF00771.22 | 0.75 | 9 | 3485 | same-strand | FHIPEP family |
| 7 | PF01312.21 | 0.75 | 9 | 5614 | same-strand | FlhB HrpN YscU SpaS Family |
++ More..