Result : Q6MDC2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | BX908798.2 |
| Organism | Protochlamydia amoebophila (strain UWE25) |
| Left | 877133 |
| Right | 877327 |
| Strand | + |
| Nucleotide Sequence | ATGCCTAAAATGAAAACCCGCAAAGCCGTTGCTTCTAAGTTTCGCGTGACGGCAACAGGCAAGCTTAAGGCTAGTCGTCCGGGCAGACGCCATAAATTGACCGGTAAAACACCTAAGCGCAAACGTCAGTTACGTCGACCAGGACTTGTAGATGATGGTCATCTCAAGACATATAAACGTCTGATGTGTTTATAA |
| Sequence | MPKMKTRKAVASKFRVTATGKLKASRPGRRHKLTGKTPKRKRQLRRPGLVDDGHLKTYKRLMCL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 15073324 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6MDC2 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 55
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1425112 | 1425306 | + | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 2 | 984188 | 984385 | + | NC_014225.1 | Waddlia chondrophila WSU 86-1044 |
| 3 | 1136123 | 1136317 | + | NC_005043.1 | Chlamydia pneumoniae TW-183 |
| 4 | 154738 | 154932 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 5 | 289727 | 289921 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 6 | 879816 | 880010 | - | NC_017287.1 | Chlamydia psittaci 6BC |
| 7 | 880607 | 880801 | - | NC_003361.3 | Chlamydia caviae GPIC |
| 8 | 838834 | 839028 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 9 | 59859 | 60056 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 10 | 2321628 | 2321825 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 11 | 1766793 | 1766990 | - | NZ_LR699011.1 | Roseburia hominis |
| 12 | 1440403 | 1440600 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 13 | 3767216 | 3767413 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 14 | 859193 | 859390 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 15 | 868506 | 868703 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 16 | 1073775 | 1073972 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
| 17 | 2327876 | 2328076 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 18 | 2334840 | 2335040 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 19 | 1796855 | 1797052 | + | NZ_CP043998.1 | Clostridium diolis |
| 20 | 4748937 | 4749134 | - | NZ_CP020953.1 | Clostridium drakei |
| 21 | 5157317 | 5157514 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 22 | 644290 | 644487 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 23 | 893027 | 893224 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 24 | 3924771 | 3924968 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 25 | 1560141 | 1560338 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 26 | 1766833 | 1767033 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 27 | 2654286 | 2654483 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 28 | 914337 | 914537 | - | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 29 | 871979 | 872176 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 30 | 3982954 | 3983151 | - | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 31 | 3353694 | 3353891 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 32 | 2047182 | 2047391 | + | NZ_AP021898.1 | Akkermansia muciniphila |
| 33 | 1282322 | 1282519 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 34 | 3711211 | 3711408 | - | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 35 | 1438915 | 1439112 | - | NC_015713.1 | Simkania negevensis Z |
| 36 | 2244482 | 2244679 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 37 | 1215653 | 1215850 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 38 | 1604616 | 1604813 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 39 | 4229180 | 4229389 | - | NZ_CP051774.1 | Luteolibacter luteus |
| 40 | 3056681 | 3056878 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 41 | 2969589 | 2969786 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 42 | 1556875 | 1557072 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 43 | 2163211 | 2163408 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 44 | 1983243 | 1983440 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 45 | 4190247 | 4190444 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 46 | 1968007 | 1968204 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 47 | 2995883 | 2996080 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 48 | 911755 | 911952 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 49 | 1591398 | 1591595 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 50 | 3110410 | 3110607 | - | NZ_CP048044.1 | Xanthomonas citri |
| 51 | 1042224 | 1042421 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 52 | 1251381 | 1251578 | + | NZ_CP029843.1 | Lysobacter maris |
| 53 | 1680231 | 1680428 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 54 | 3170603 | 3170800 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 55 | 2472260 | 2472457 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012395.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03129.22 | 0.65 | 36 | 830.0 | same-strand | Anticodon binding domain |
| 2 | PF00707.24 | 0.95 | 52 | 30.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 3 | PF05198.18 | 0.69 | 38 | 22.0 | same-strand | Translation initiation factor IF-3, N-terminal domain |
| 4 | PF00453.20 | 1.0 | 55 | 19 | same-strand | Ribosomal protein L20 |
| 5 | PF01409.22 | 0.75 | 41 | 624.5 | same-strand | tRNA synthetases class II core domain (F) |
| 6 | PF02912.20 | 0.73 | 40 | 624.5 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 7 | PF00587.27 | 0.62 | 34 | 831.5 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 8 | PF07973.16 | 0.62 | 34 | 831.5 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..