Result : A8MH81
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000853.1 |
| Organism | Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs)) |
| Left | 1532155 |
| Right | 1532370 |
| Strand | + |
| Nucleotide Sequence | ATGTTATACCCACCAATTAATGAACTATTAGATAAAGTCGATAGCAGATATACATTAGTAGTAGCTGCTGCAAAAAGGGCAAGACAATTAATCGACGGAGCTGTGCCAAAGATTGAGATGCCTTATTCTAAAAAGCCAGTATCAATTGCTACCCAAGAAATATACGAATCCTACGTGCTTTATACAAGTGGAGAAGATGAAACTGATATTGAGTAA |
| Sequence | MLYPPINELLDKVDSRYTLVVAAAKRARQLIDGAVPKIEMPYSKKPVSIATQEIYESYVLYTSGEDETDIE |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A8MH81 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 61
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1532155 | 1532370 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 2 | 1280488 | 1280694 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 3 | 2174024 | 2174230 | - | NZ_CP009687.1 | Clostridium aceticum |
| 4 | 2421907 | 2422128 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 5 | 344254 | 344457 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 6 | 2806623 | 2806829 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 7 | 1389578 | 1389784 | + | NZ_CP048649.1 | Aminipila butyrica |
| 8 | 1193915 | 1194130 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 9 | 6446444 | 6446659 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 10 | 2465936 | 2466142 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 11 | 1100474 | 1100680 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 12 | 2227028 | 2227237 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 13 | 4344620 | 4344847 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 14 | 926763 | 926972 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 15 | 2146289 | 2146495 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 16 | 2259754 | 2259960 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 17 | 4869185 | 4869400 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 18 | 995126 | 995326 | + | NZ_CP033433.1 | Cohnella candidum |
| 19 | 2244607 | 2244822 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 20 | 1133165 | 1133365 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 21 | 720094 | 720297 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 22 | 3536425 | 3536622 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 23 | 3206915 | 3207121 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 24 | 1765032 | 1765265 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 25 | 1149097 | 1149303 | + | NZ_CP020953.1 | Clostridium drakei |
| 26 | 879521 | 879727 | - | NZ_CP029256.1 | Christensenella minuta |
| 27 | 1790295 | 1790501 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 28 | 110232 | 110438 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 29 | 3118913 | 3119119 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 30 | 2005959 | 2006171 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 31 | 331754 | 331951 | + | NZ_LT996885.1 | Dialister massiliensis |
| 32 | 1112305 | 1112535 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 33 | 97472 | 97672 | - | NZ_CP045298.1 | Paenibacillus brasilensis |
| 34 | 2249248 | 2249469 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 35 | 2148535 | 2148735 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 36 | 1834236 | 1834442 | + | NZ_CP014176.1 | Clostridium argentinense |
| 37 | 4455120 | 4455323 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 38 | 1018945 | 1019151 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 39 | 2340956 | 2341159 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 40 | 1293683 | 1293889 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 41 | 223319 | 223525 | - | NZ_CP023671.1 | Clostridium septicum |
| 42 | 1154845 | 1155054 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 43 | 586483 | 586683 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 44 | 1010059 | 1010268 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 45 | 2814594 | 2814794 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 46 | 3589361 | 3589567 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 47 | 1353305 | 1353511 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 48 | 1508805 | 1509014 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 49 | 1570106 | 1570321 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 50 | 1654330 | 1654536 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 51 | 1638749 | 1638958 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 52 | 2671222 | 2671422 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 53 | 940570 | 940782 | + | NZ_LT906470.1 | Veillonella rodentium |
| 54 | 1071214 | 1071402 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 55 | 1471807 | 1472019 | + | NZ_CP040336.1 | Bacillus luti |
| 56 | 1107260 | 1107472 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 57 | 1165395 | 1165607 | - | NZ_LR134375.1 | Veillonella dispar |
| 58 | 1401133 | 1401336 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 59 | 1210192 | 1210404 | - | NZ_LR778174.1 | Veillonella parvula |
| 60 | 3126633 | 3126833 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 61 | 1123918 | 1124112 | + | NZ_CP011366.1 | Salinicoccus halodurans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009922.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03755.15 | 0.89 | 54 | 931.5 | same-strand | YicC-like family, N-terminal region |
| 2 | PF08340.13 | 0.89 | 54 | 931.5 | same-strand | Domain of unknown function (DUF1732) |
| 3 | PF04025.14 | 0.93 | 57 | 639 | same-strand | Domain of unknown function (DUF370) |
| 4 | PF00625.23 | 0.95 | 58 | 8.0 | same-strand | Guanylate kinase |
| 5 | PF13238.8 | 0.87 | 53 | 8 | same-strand | AAA domain |
| 6 | PF04127.17 | 0.93 | 57 | 53 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 7 | PF02441.21 | 0.93 | 57 | 53 | same-strand | Flavoprotein |
| 8 | PF17764.3 | 0.84 | 51 | 1306 | same-strand | 3'DNA-binding domain (3'BD) |
| 9 | PF04851.17 | 0.84 | 51 | 1306 | same-strand | Type III restriction enzyme, res subunit |
| 10 | PF00270.31 | 0.84 | 51 | 1306 | same-strand | DEAD/DEAH box helicase |
| 11 | PF18074.3 | 0.84 | 51 | 1306 | same-strand | Primosomal protein N C-terminal domain |
| 12 | PF18319.3 | 0.84 | 51 | 1306 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
| 13 | PF01327.23 | 0.82 | 50 | 3827.0 | same-strand | Polypeptide deformylase |
| 14 | PF00551.21 | 0.79 | 48 | 4281.5 | same-strand | Formyl transferase |
| 15 | PF02911.20 | 0.79 | 48 | 4281.5 | same-strand | Formyl transferase, C-terminal domain |
++ More..