Result : Q6LVI6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein ZapB |
| NCBI Accession ID | CR378663.1 |
| Organism | Photobacterium profundum (strain SS9) |
| Left | 257899 |
| Right | 258150 |
| Strand | + |
| Nucleotide Sequence | GTGAACAATATGTCATTAGAAATGCTGGAAAAGCTAGAAGCCAAAGTACAAATGGCTGTTGATACAATTTCGTTGCTTCAGATGGAAATTGAAGAATTAAAAGAAACGAACGAAAGTTTAACGGCTGAAGCAAATGAGTTACGCTCAAACCGTGAAACGCTTGCACAAGATAATGATAAATTACAAAATGATCATCAAGCGTGGCAAGAACGTGTTCGCACTTTGCTAGGCAAGATGGATCACGTAGAATAA |
| Sequence | MNNMSLEMLEKLEAKVQMAVDTISLLQMEIEELKETNESLTAEANELRSNRETLAQDNDKLQNDHQAWQERVRTLLGKMDHVE |
| Source of smORF | Swiss-Prot |
| Function | Non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA. {ECO:0000255|HAMAP-Rule:MF_01196}. |
| Pubmed ID | 15746425 |
| Domain | CDD:416309 |
| Functional Category | Others |
| Uniprot ID | Q6LVI6 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 205
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 536674 | 536925 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 2 | 515739 | 515990 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 3 | 194723 | 194965 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 4 | 1054779 | 1055021 | - | NZ_CP014056.2 | Grimontia hollisae |
| 5 | 3002200 | 3002442 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 6 | 1970207 | 1970449 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 7 | 2867159 | 2867401 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 8 | 1558072 | 1558314 | - | NZ_CP019959.1 | Vibrio owensii |
| 9 | 2836288 | 2836530 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 10 | 2374586 | 2374828 | - | NZ_CP035688.1 | Vibrio metoecus |
| 11 | 2715412 | 2715654 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 12 | 473695 | 473937 | + | NZ_CP009467.1 | Vibrio harveyi |
| 13 | 96247 | 96465 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 14 | 193570 | 193812 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 15 | 266437 | 266679 | + | NZ_CP030788.1 | Vibrio campbellii |
| 16 | 228707 | 228949 | + | NZ_CP040021.1 | Salinivibrio kushneri |
| 17 | 228834 | 229076 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 18 | 3065919 | 3066161 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 19 | 232572 | 232814 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 20 | 1707987 | 1708229 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 21 | 3059481 | 3059723 | - | NC_011753.2 | Vibrio atlanticus |
| 22 | 2650830 | 2651072 | - | NZ_CP033078.1 | Vibrio zhugei |
| 23 | 5548238 | 5548480 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 24 | 3211850 | 3212092 | - | NZ_AP014635.1 | Vibrio tritonius |
| 25 | 1637813 | 1638055 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 26 | 4925105 | 4925347 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 27 | 4159374 | 4159613 | - | NZ_LS483422.1 | Providencia heimbachae |
| 28 | 4416196 | 4416438 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 29 | 219169 | 219408 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 30 | 2633862 | 2634104 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 31 | 3675799 | 3676041 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 32 | 3722130 | 3722372 | - | NZ_LR134531.1 | Pragia fontium |
| 33 | 2084752 | 2084994 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 34 | 4568569 | 4568808 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 35 | 62547 | 62789 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 36 | 4237776 | 4238015 | - | NZ_CP015581.1 | Tatumella citrea |
| 37 | 217550 | 217792 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 38 | 1734691 | 1734933 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 39 | 80577 | 80819 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 40 | 4304050 | 4304289 | - | NZ_LT615367.1 | Dickeya aquatica |
| 41 | 101930 | 102172 | + | NZ_CP050150.1 | Hafnia alvei |
| 42 | 1649246 | 1649488 | + | NZ_CP026364.1 | Proteus hauseri |
| 43 | 4559616 | 4559855 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 44 | 2569806 | 2570048 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 45 | 3742022 | 3742261 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 46 | 3212128 | 3212370 | - | NZ_CP016176.1 | Xenorhabdus hominickii |
| 47 | 254174 | 254413 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 48 | 1358591 | 1358821 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 49 | 197764 | 198006 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 50 | 3537314 | 3537556 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 51 | 1798347 | 1798589 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 52 | 129345 | 129587 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 53 | 3527070 | 3527312 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 54 | 1081887 | 1082126 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 55 | 207918 | 208160 | + | NC_014500.1 | Dickeya dadantii 3937 |
| 56 | 3077375 | 3077617 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 57 | 4655057 | 4655299 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 58 | 1138046 | 1138285 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 59 | 917950 | 918189 | + | NZ_CP029736.1 | Providencia rettgeri |
| 60 | 3620481 | 3620720 | - | NZ_CP031123.2 | Providencia huaxiensis |
| 61 | 1889699 | 1889941 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 62 | 4461829 | 4462068 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 63 | 3083465 | 3083707 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 64 | 2009457 | 2009708 | - | NZ_CP021376.1 | Oceanisphaera avium |
| 65 | 347587 | 347826 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 66 | 295295 | 295525 | + | NZ_CP046268.1 | Vibrio spartinae |
| 67 | 3226762 | 3227004 | - | NZ_CP060401.1 | Xenorhabdus nematophila |
| 68 | 4440009 | 4440251 | - | NZ_CP025799.1 | Dickeya zeae |
| 69 | 195623 | 195862 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 70 | 3843749 | 3843988 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 71 | 132614 | 132853 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 72 | 106801 | 107040 | + | NZ_CP043727.1 | Yersinia canariae |
| 73 | 4587427 | 4587666 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 74 | 109304 | 109543 | + | NZ_CP032487.1 | Yersinia hibernica |
| 75 | 148704 | 148943 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 76 | 2802301 | 2802543 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 77 | 1598798 | 1599037 | - | NZ_CP011254.1 | Serratia fonticola |
| 78 | 2996385 | 2996624 | + | NZ_CP009787.1 | Yersinia rohdei |
| 79 | 4474264 | 4474503 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 80 | 1726088 | 1726327 | + | NZ_CP007230.1 | Yersinia similis |
| 81 | 1089474 | 1089713 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 82 | 1502458 | 1502709 | - | NZ_CP021377.1 | Oceanisphaera profunda |
| 83 | 4685039 | 4685278 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 84 | 2148180 | 2148419 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 85 | 3509250 | 3509489 | - | NZ_CP067057.1 | Rahnella aceris |
| 86 | 4005161 | 4005400 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 87 | 110374 | 110601 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 88 | 4242612 | 4242854 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 89 | 3550948 | 3551187 | - | NZ_CP028271.1 | Mixta intestinalis |
| 90 | 2818702 | 2818944 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 91 | 1819968 | 1820207 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 92 | 195542 | 195781 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 93 | 207988 | 208227 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 94 | 3496628 | 3496867 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 95 | 167021 | 167260 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 96 | 3866567 | 3866806 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 97 | 1479620 | 1479859 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 98 | 4516425 | 4516664 | - | NZ_LR134201.1 | Cedecea lapagei |
| 99 | 4940360 | 4940599 | - | NZ_CP023525.1 | Cedecea neteri |
| 100 | 2576569 | 2576808 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 101 | 4576956 | 4577195 | - | NZ_CP046293.1 | Yersinia intermedia |
| 102 | 4297128 | 4297367 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 103 | 3975877 | 3976116 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 104 | 2995261 | 2995503 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 105 | 1351913 | 1352152 | - | NZ_CP065640.1 | Serratia rubidaea |
| 106 | 4157019 | 4157258 | - | NZ_CP048796.1 | Providencia vermicola |
| 107 | 4112517 | 4112759 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 108 | 1748893 | 1749132 | + | NZ_CP019706.1 | Pantoea alhagi |
| 109 | 3650205 | 3650447 | - | NZ_CP065534.1 | Lonsdalea populi |
| 110 | 937663 | 937905 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 111 | 76239 | 76478 | + | NZ_CP071320.1 | Serratia ureilytica |
| 112 | 4325481 | 4325720 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 113 | 5116911 | 5117150 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 114 | 168217 | 168456 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 115 | 176712 | 176951 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 116 | 189400 | 189639 | + | NZ_CP038853.1 | Pantoea vagans |
| 117 | 4521702 | 4521941 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 118 | 2676074 | 2676313 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 119 | 108187 | 108429 | + | NZ_LS483470.1 | Leminorella richardii |
| 120 | 5157854 | 5158093 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 121 | 203229 | 203471 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 122 | 5068708 | 5068947 | - | NZ_LT906479.1 | Serratia ficaria |
| 123 | 95274 | 95501 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 124 | 5194202 | 5194429 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 125 | 5298462 | 5298701 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 126 | 208755 | 208982 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 127 | 202916 | 203143 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 128 | 3241509 | 3241748 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 129 | 3851696 | 3851923 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 130 | 4107069 | 4107308 | - | NZ_CP061511.1 | Mixta calida |
| 131 | 4412900 | 4413139 | - | NZ_CP026377.1 | Mixta gaviniae |
| 132 | 3056202 | 3056441 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 133 | 39094 | 39333 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 134 | 4133598 | 4133837 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 135 | 4918703 | 4918942 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 136 | 144733 | 144972 | + | NZ_LR134340.1 | Escherichia marmotae |
| 137 | 4118521 | 4118760 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 138 | 4086662 | 4086901 | + | NZ_AP014857.1 | Escherichia albertii |
| 139 | 3068551 | 3068793 | + | NZ_AP019657.1 | Vibrio ponticus |
| 140 | 43049 | 43288 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 141 | 190825 | 191064 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 142 | 4569061 | 4569288 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 143 | 5212965 | 5213204 | - | NZ_LR134494.1 | Serratia quinivorans |
| 144 | 2075665 | 2075904 | + | NZ_CP053416.1 | Salmonella bongori |
| 145 | 138182 | 138421 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 146 | 214919 | 215161 | - | NZ_CP040990.1 | Vibrio furnissii |
| 147 | 5285427 | 5285666 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 148 | 5441347 | 5441586 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 149 | 156454 | 156693 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 150 | 3249526 | 3249729 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 151 | 3038710 | 3038949 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 152 | 4722484 | 4722723 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 153 | 96948 | 97175 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 154 | 93315 | 93542 | + | NZ_CP054254.1 | Klebsiella variicola |
| 155 | 1576927 | 1577166 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 156 | 963467 | 963694 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 157 | 4026590 | 4026829 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 158 | 742801 | 743028 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 159 | 3215854 | 3216093 | - | NZ_CP038469.1 | Citrobacter tructae |
| 160 | 96511 | 96714 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 161 | 94866 | 95105 | + | NZ_CP050508.1 | Raoultella terrigena |
| 162 | 4503501 | 4503740 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 163 | 3008582 | 3008821 | + | NZ_CP049115.1 | Pantoea stewartii |
| 164 | 2194294 | 2194533 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 165 | 987511 | 987750 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 166 | 2577841 | 2578080 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 167 | 4287283 | 4287522 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 168 | 137741 | 137980 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 169 | 2886945 | 2887184 | + | NZ_CP033744.1 | Citrobacter freundii |
| 170 | 84072 | 84299 | + | NZ_CP041247.1 | Raoultella electrica |
| 171 | 1616558 | 1616785 | - | NZ_CP026047.1 | Raoultella planticola |
| 172 | 105746 | 105973 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 173 | 4602864 | 4603103 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 174 | 4610963 | 4611202 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 175 | 2704278 | 2704517 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 176 | 3114320 | 3114559 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 177 | 4966505 | 4966744 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 178 | 3009929 | 3010171 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 179 | 336692 | 336934 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 180 | 4669829 | 4670068 | - | NC_015968.1 | Enterobacter soli |
| 181 | 4415111 | 4415350 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 182 | 3717491 | 3717730 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 183 | 141504 | 141743 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 184 | 3352582 | 3352821 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 185 | 138931 | 139173 | - | NC_013456.1 | Vibrio antiquarius |
| 186 | 2847482 | 2847721 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 187 | 118541 | 118780 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 188 | 4555553 | 4555783 | - | NZ_CP028897.1 | Dongshaea marina |
| 189 | 163070 | 163297 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 190 | 199683 | 199892 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 191 | 3963064 | 3963273 | + | NZ_CP040449.1 | Aeromonas simiae |
| 192 | 3386554 | 3386763 | + | NZ_CP044060.1 | Aeromonas veronii |
| 193 | 3634937 | 3635146 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 194 | 202166 | 202375 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 195 | 4592848 | 4593057 | - | NZ_AP022188.1 | Aeromonas media |
| 196 | 538584 | 538802 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 197 | 368948 | 369166 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 198 | 492792 | 493010 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 199 | 3026973 | 3027182 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 200 | 1001250 | 1001468 | - | NZ_CP028926.1 | Pasteurella multocida |
| 201 | 1379 | 1597 | - | NZ_CP018804.1 | Histophilus somni |
| 202 | 4245735 | 4245944 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 203 | 1419355 | 1419573 | - | NZ_CP016604.1 | Otariodibacter oris |
| 204 | 3693357 | 3693566 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 205 | 1651940 | 1652158 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 206 | 191147 | 191365 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP005974.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03320.15 | 0.74 | 152 | 2957 | opposite-strand | Bacterial fructose-1,6-bisphosphatase, glpX-encoded |
| 2 | PF00370.23 | 0.74 | 152 | 1327 | opposite-strand | FGGY family of carbohydrate kinases, N-terminal domain |
| 3 | PF02782.18 | 0.74 | 152 | 1327 | opposite-strand | FGGY family of carbohydrate kinases, C-terminal domain |
| 4 | PF00230.22 | 0.73 | 150 | 450 | opposite-strand | Major intrinsic protein |
| 5 | PF03737.17 | 0.78 | 159 | 105.0 | opposite-strand | Aldolase/RraA |
| 6 | PF01040.20 | 0.69 | 142 | 718 | opposite-strand | UbiA prenyltransferase family |
| 7 | PF07724.16 | 0.77 | 157 | 1777.0 | opposite-strand | AAA domain (Cdc48 subfamily) |
| 8 | PF00227.28 | 0.74 | 151 | 3116 | opposite-strand | Proteasome subunit |
| 9 | PF05036.15 | 0.67 | 138 | 3734.5 | opposite-strand | SPOR domain |
++ More..