Result : Q6LVD0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein SlyX homolog |
| NCBI Accession ID | CR378663.1 |
| Organism | Photobacterium profundum (strain SS9) |
| Left | 322494 |
| Right | 322730 |
| Strand | - |
| Nucleotide Sequence | TTGGTACCTAACCTCATGACCGATATTGAAAAACTACAAGTTCAAGTTGACGAGCTAGAAATGAAGCAAGCTTTTCAAGAACAAACAATCGATGATCTCAACGAAGCACTCACTGATCAGCAATTCCAATTTGATAAAATGCAGGTTCAGCTTAAATTTTTAGTGGGTAAAGTTAAAGGCTTCCAGTCATCAAATATGGCCGAAGAATCGGAAGAGACGCCTCCTCCACACTATTGA |
| Sequence | MVPNLMTDIEKLQVQVDELEMKQAFQEQTIDDLNEALTDQQFQFDKMQVQLKFLVGKVKGFQSSNMAEESEETPPPHY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01090. Profile Description: SlyX. hypothetical protein; Provisional |
| Pubmed ID | 15746425 |
| Domain | CDD:412736 |
| Functional Category | Others |
| Uniprot ID | Q6LVD0 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 595980 | 596201 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 2 | 573845 | 574066 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 3 | 255050 | 255271 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 4 | 349477 | 349701 | - | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 5 | 2469157 | 2469369 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 6 | 508463 | 508684 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 7 | 451435 | 451641 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 8 | 522882 | 523088 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 9 | 986453 | 986677 | + | NZ_CP014056.2 | Grimontia hollisae |
| 10 | 3080782 | 3081012 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 11 | 2931799 | 2932002 | + | NZ_CP030788.1 | Vibrio campbellii |
| 12 | 115716 | 115919 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 13 | 3505925 | 3506128 | + | NZ_CP009467.1 | Vibrio harveyi |
| 14 | 285650 | 285877 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 15 | 329666 | 329893 | - | NZ_AP014635.1 | Vibrio tritonius |
| 16 | 1773586 | 1773777 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 17 | 2127508 | 2127729 | + | NZ_CP018804.1 | Histophilus somni |
| 18 | 1306684 | 1306905 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 19 | 2795379 | 2795603 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 20 | 1642837 | 1643058 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 21 | 298892 | 299083 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 22 | 304507 | 304722 | - | NZ_AP018685.1 | Vibrio rumoiensis |
| 23 | 4027282 | 4027494 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 24 | 778293 | 778493 | - | NZ_CP040990.1 | Vibrio furnissii |
| 25 | 744738 | 744941 | - | NC_013456.1 | Vibrio antiquarius |
| 26 | 2148683 | 2148886 | - | NZ_CP019959.1 | Vibrio owensii |
| 27 | 2570041 | 2570244 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 28 | 2989347 | 2989538 | + | NC_011753.2 | Vibrio atlanticus |
| 29 | 94634 | 94861 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 30 | 307176 | 307403 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 31 | 1476136 | 1476363 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 32 | 318872 | 319075 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 33 | 806873 | 807064 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 34 | 292098 | 292319 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 35 | 269611 | 269841 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 36 | 3189913 | 3190140 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 37 | 395217 | 395423 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 38 | 2239452 | 2239643 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 39 | 2587098 | 2587325 | + | NZ_AP019657.1 | Vibrio ponticus |
| 40 | 725252 | 725476 | + | NZ_CP028926.1 | Pasteurella multocida |
| 41 | 470329 | 470532 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 42 | 371148 | 371369 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 43 | 1361860 | 1362066 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 44 | 308413 | 308640 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 45 | 40622 | 40843 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 46 | 240170 | 240397 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 47 | 277327 | 277539 | - | NZ_CP033078.1 | Vibrio zhugei |
| 48 | 441655 | 441876 | - | NZ_LR134167.1 | Avibacterium volantium |
| 49 | 2854762 | 2854989 | - | NZ_CP035688.1 | Vibrio metoecus |
| 50 | 251343 | 251561 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 51 | 507322 | 507543 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 52 | 3410811 | 3411038 | + | NZ_CP046268.1 | Vibrio spartinae |
| 53 | 1936394 | 1936633 | - | NZ_CP052766.1 | Alteromonas pelagimontana |
| 54 | 2008365 | 2008586 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 55 | 3081377 | 3081583 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 56 | 2034572 | 2034793 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 57 | 2085804 | 2086025 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 58 | 1977435 | 1977656 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 59 | 2485204 | 2485425 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 60 | 4359954 | 4360202 | - | NZ_CP046670.1 | Alteromonas mediterranea |
| 61 | 1983956 | 1984180 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 62 | 337229 | 337450 | + | NZ_CP061280.1 | Mannheimia bovis |
| 63 | 3007676 | 3007879 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 64 | 3344862 | 3345089 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 65 | 2962105 | 2962296 | + | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP005974.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00254.30 | 1.0 | 65 | 1122.5 | opposite-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 2 | PF01346.20 | 1.0 | 65 | 1118.0 | opposite-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 3 | PF08348.13 | 0.92 | 60 | 2063.0 | opposite-strand | YheO-like PAS domain |
| 4 | PF13309.8 | 0.92 | 60 | 2063.0 | opposite-strand | HTH domain |
| 5 | PF02635.17 | 0.94 | 61 | 2782.0 | opposite-strand | DsrE/DsrF-like family |
++ More..