Result : Q6LMG5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | CR378673.1 |
| Organism | Photobacterium profundum (strain SS9) |
| Left | 157612 |
| Right | 157842 |
| Strand | + |
| Nucleotide Sequence | TTGCTGAGGTTACCCGTGTCACAATCAAACACGCCAACAACACCCATTATTGTTAAATGCCCAACGTGCAAGAAAGAAGTAGAATGGGGAGAGCAAAGCCCTTACCGCCCTTTTTGTACCAAACGTTGTCAGTTAATTGATCTGGGTGAATGGGCAGAAGAAGAGAAGTCAATTCCTGGCGCACCTGATCTATCTGACTCAGATGGCTGGTCGGATGATATGGGATATTAA |
| Sequence | MLRLPVSQSNTPTTPIIVKCPTCKKEVEWGEQSPYRPFCTKRCQLIDLGEWAEEEKSIPGAPDLSDSDGWSDDMGY |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 15746425 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q6LMG5 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 100
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 387309 | 387542 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 2 | 724976 | 725185 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 3 | 2123806 | 2124006 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 4 | 103731 | 103958 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 5 | 3235128 | 3235325 | + | NZ_CP040990.1 | Vibrio furnissii |
| 6 | 2399275 | 2399472 | + | NZ_CP033078.1 | Vibrio zhugei |
| 7 | 2319180 | 2319383 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 8 | 252706 | 252900 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 9 | 2745301 | 2745498 | + | NC_011753.2 | Vibrio atlanticus |
| 10 | 2009874 | 2010071 | - | NZ_CP065150.1 | Vibrio kanaloae |
| 11 | 261272 | 261481 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 12 | 439009 | 439209 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 13 | 1028150 | 1028344 | - | NC_013456.1 | Vibrio antiquarius |
| 14 | 2802073 | 2802267 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 15 | 602370 | 602564 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 16 | 434462 | 434656 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 17 | 2850904 | 2851113 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 18 | 2434548 | 2434742 | - | NZ_CP019959.1 | Vibrio owensii |
| 19 | 2646371 | 2646565 | + | NZ_CP030788.1 | Vibrio campbellii |
| 20 | 820983 | 821177 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 21 | 3809905 | 3810117 | + | NZ_LT615367.1 | Dickeya aquatica |
| 22 | 4122530 | 4122715 | + | NZ_CP031560.1 | Dickeya dianthicola |
| 23 | 3703081 | 3703284 | - | NZ_CP009787.1 | Yersinia rohdei |
| 24 | 3939134 | 3939319 | + | NZ_CP025799.1 | Dickeya zeae |
| 25 | 3865889 | 3866083 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 26 | 604201 | 604392 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 27 | 838942 | 839148 | - | NZ_CP032487.1 | Yersinia hibernica |
| 28 | 2937508 | 2937708 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 29 | 3743205 | 3743411 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 30 | 4483391 | 4483585 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 31 | 2997478 | 2997678 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 32 | 2268744 | 2268938 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 33 | 1015894 | 1016091 | - | NZ_LR134531.1 | Pragia fontium |
| 34 | 3868193 | 3868399 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 35 | 3852475 | 3852681 | + | NZ_CP046293.1 | Yersinia intermedia |
| 36 | 825376 | 825573 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 37 | 733899 | 734093 | - | NZ_LR134340.1 | Escherichia marmotae |
| 38 | 3513804 | 3514010 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 39 | 971080 | 971280 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 40 | 2471453 | 2471659 | - | NZ_CP007230.1 | Yersinia similis |
| 41 | 850068 | 850274 | - | NZ_CP043727.1 | Yersinia canariae |
| 42 | 2060826 | 2061032 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 43 | 3957287 | 3957481 | + | NZ_CP038498.1 | Pectobacterium punjabense |
| 44 | 3201242 | 3201436 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 45 | 2764196 | 2764390 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 46 | 3828025 | 3828225 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 47 | 887865 | 888068 | - | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 48 | 3111961 | 3112161 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 49 | 3102883 | 3103068 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 50 | 792211 | 792408 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 51 | 3371914 | 3372099 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 52 | 3394291 | 3394488 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 53 | 3333122 | 3333307 | + | NZ_CP038853.1 | Pantoea vagans |
| 54 | 2955121 | 2955315 | + | NZ_CP017482.1 | Pectobacterium polaris |
| 55 | 586107 | 586310 | - | NZ_CP046268.1 | Vibrio spartinae |
| 56 | 3745065 | 3745262 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 57 | 2366584 | 2366775 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 58 | 716523 | 716714 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 59 | 3646000 | 3646197 | - | NZ_CP049115.1 | Pantoea stewartii |
| 60 | 472704 | 472895 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 61 | 4152240 | 4152434 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
| 62 | 4123357 | 4123551 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 63 | 727273 | 727467 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 64 | 2174692 | 2174889 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 65 | 87667 | 87852 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 66 | 501446 | 501658 | - | NZ_CP009056.1 | Frischella perrara |
| 67 | 4470055 | 4470267 | + | NZ_CP046378.1 | Shewanella algae |
| 68 | 917897 | 918097 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 69 | 4851971 | 4852159 | + | NZ_CP024159.1 | Pseudomonas mosselii |
| 70 | 1674746 | 1674973 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 71 | 1198056 | 1198241 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 72 | 116166 | 116357 | - | NZ_CP012676.1 | Pseudomonas versuta |
| 73 | 3009188 | 3009409 | + | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 74 | 1703650 | 1703880 | - | NZ_CP021435.1 | Halomonas beimenensis |
| 75 | 804111 | 804299 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 76 | 3115364 | 3115552 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 77 | 1140452 | 1140661 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 78 | 4193028 | 4193216 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 79 | 5102593 | 5102808 | + | NZ_CP037952.1 | Parashewanella spongiae |
| 80 | 5517423 | 5517626 | + | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 81 | 855095 | 855286 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 82 | 4110757 | 4110969 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 83 | 3838625 | 3838837 | + | NZ_CP022272.1 | Shewanella marisflavi |
| 84 | 5844455 | 5844640 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 85 | 4327975 | 4328169 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 86 | 5737426 | 5737626 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 87 | 5581672 | 5581872 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 88 | 767040 | 767240 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 89 | 4344286 | 4344489 | - | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 90 | 5074172 | 5074372 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 91 | 5242622 | 5242810 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 92 | 4875833 | 4876033 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 93 | 5382804 | 5383004 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 94 | 949977 | 950165 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 95 | 4087281 | 4087472 | + | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 96 | 4417794 | 4417985 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 97 | 892868 | 893056 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 98 | 5004103 | 5004312 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 99 | 1392520 | 1392717 | + | NC_021291.1 | Spiribacter salinus M19-40 |
| 100 | 1052892 | 1053092 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071325.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07072.13 | 0.71 | 71 | 45 | same-strand | Cell division protein |
| 2 | PF01121.22 | 0.97 | 97 | 775 | same-strand | Dephospho-CoA kinase |
| 3 | PF00482.25 | 0.95 | 95 | 2388.0 | same-strand | Type II secretion system (T2SS), protein F |
| 4 | PF00437.22 | 0.76 | 76 | 3668 | same-strand | Type II/IV secretion system protein |
++ More..