Protein Information |
Information Type | Description |
---|---|
Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
NCBI Accession ID | AE017308.1 |
Organism | Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) |
Left | 282906 |
Right | 283205 |
Strand | - |
Nucleotide Sequence | ATGAATGATTTAATTACAAATTTAGCACTTCCACAAGAAGTTATTAATGCTGCTGGCTCAAATAACGGAGCAGGAATTGGTTATGGCTTAGTTGCAGTTGGAGCTGGACTTGCAATGATTGGGGCCTTAGGTACAGGGCTTGGACAAGGTGTTAGTGCAGGTAAAGCAGCAGAAGCTGTTGGGAGAAACCCTGAGGCTGAAGCAAAAATTAGATTAATGATGATTATTGGTATGGGAATTGCTGAAACAGCTGCTATCTATTCTTTAATCATTGCTATTTTATTAATTTTTGTTTACTAA |
Sequence | MNDLITNLALPQEVINAAGSNNGAGIGYGLVAVGAGLAMIGALGTGLGQGVSAGKAAEAVGRNPEAEAKIRLMMIIGMGIAETAAIYSLIIAILLIFVY |
Source of smORF | Swiss-Prot |
Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
Pubmed ID | 15289470 |
Domain | CDD:412393 |
Functional Category | Others |
Uniprot ID | Q6KI76 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 282906 | 283205 | - | NC_006908.1 | Mycoplasma mobile 163K |
2 | 352779 | 353096 | - | NZ_CP040825.1 | Mycoplasma nasistruthionis |
3 | 436117 | 436422 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
4 | 316527 | 316805 | - | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
5 | 286346 | 286651 | + | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
6 | 252064 | 252351 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
7 | 430482 | 430787 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
8 | 88217 | 88510 | + | NZ_CP007154.1 | Mycoplasma bovoculi M165/69 |
9 | 242769 | 243053 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
10 | 193200 | 193487 | + | NZ_CP030141.1 | Mycoplasmopsis anatis |
11 | 481062 | 481370 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
12 | 43881 | 44186 | + | NZ_CP024161.1 | Mycoplasma dispar |
13 | 448481 | 448789 | - | NZ_LS991949.1 | Mycoplasma alkalescens |
14 | 433894 | 434184 | - | NZ_CP034044.1 | Mycoplasma struthionis |
15 | 125373 | 125669 | + | NZ_CP029295.1 | Mycoplasma phocidae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00306.29 | 0.93 | 14 | 1879.0 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
2 | PF02874.25 | 1.0 | 15 | 1129.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
3 | PF00213.20 | 0.73 | 11 | 605 | same-strand | ATP synthase delta (OSCP) subunit |
4 | PF00430.20 | 0.93 | 14 | 26.0 | same-strand | ATP synthase B/B' CF(0) |
5 | PF00231.21 | 0.6 | 9 | 2722 | same-strand | ATP synthase |