Result : Q6KHL4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | AE017308.1 |
| Organism | Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) |
| Left | 537222 |
| Right | 537485 |
| Strand | - |
| Nucleotide Sequence | ATGGTTAAGTTAAGACTTAAAAGAATGGGAAGTAAATTTAATGCTTTTTATAGAATCGTAGCAGCTGATGCAAGAGCACCTAGAGATGGGCGTTTTATTGAAGAATTAGGTTATTATAATCCTTTTTCTAAGGATTTAAAAATTGAAAAAGAATTAGTTTTTAAATGATTAGATCTTGGAGCAAAACCAACTGAAACAACTAAAACATTATTTAAAAAGGAAAAAATAATGGAACAATATCACCAAAAAAGGCAAAAAAATTAA |
| Sequence | MVKLRLKRMGSKFNAFYRIVAADARAPRDGRFIEELGYYNPFSKDLKIEKELVFKWLDLGAKPTETTKTLFKKEKIMEQYHQKRQKN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 15289470 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6KHL4 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 399
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1779009 | 1779254 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 2 | 1801619 | 1801864 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 3 | 1800980 | 1801225 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 4 | 96266 | 96523 | + | NZ_CP030140.1 | Mycoplasma anseris |
| 5 | 497522 | 497782 | - | NZ_CP030103.1 | Mycoplasma cloacale |
| 6 | 1226861 | 1227109 | - | NZ_CP045007.1 | Latilactobacillus graminis |
| 7 | 246858 | 247106 | + | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 8 | 1523793 | 1524041 | + | NZ_CP046037.1 | Latilactobacillus sakei |
| 9 | 230059 | 230316 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 10 | 1852009 | 1852254 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 11 | 1677767 | 1678012 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 12 | 1641447 | 1641692 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 13 | 1646518 | 1646763 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 14 | 312234 | 312479 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 15 | 1673647 | 1673892 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 16 | 2332271 | 2332516 | - | NZ_CP011937.1 | Bacillus velezensis |
| 17 | 1628630 | 1628875 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 18 | 1581329 | 1581574 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 19 | 1706881 | 1707123 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 20 | 551935 | 552147 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 21 | 2573814 | 2574059 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 22 | 573155 | 573400 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 23 | 2165528 | 2165794 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 24 | 2421074 | 2421316 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 25 | 1604715 | 1604963 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 26 | 1857095 | 1857313 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 27 | 214657 | 214911 | - | NZ_CP029295.1 | Mycoplasma phocidae |
| 28 | 2379027 | 2379245 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 29 | 1764120 | 1764365 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 30 | 2586248 | 2586493 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 31 | 1444268 | 1444513 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 32 | 1137960 | 1138205 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 33 | 652778 | 653023 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 34 | 970950 | 971201 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 35 | 2045521 | 2045766 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 36 | 1755081 | 1755326 | + | NZ_CP019323.1 | Companilactobacillus allii |
| 37 | 2151016 | 2151261 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 38 | 2567570 | 2567815 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 39 | 617995 | 618240 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 40 | 1501319 | 1501564 | + | NZ_CP040336.1 | Bacillus luti |
| 41 | 3658378 | 3658623 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 42 | 3727923 | 3728168 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 43 | 3862973 | 3863218 | - | NC_011725.1 | Bacillus cereus B4264 |
| 44 | 3867215 | 3867460 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 45 | 3988732 | 3988977 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 46 | 1415295 | 1415531 | - | NZ_CP023434.1 | Suicoccus acidiformans |
| 47 | 3397907 | 3398152 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 48 | 1007644 | 1007892 | + | NZ_CP047361.1 | Macrococcus canis |
| 49 | 508985 | 509230 | + | NZ_CP014161.1 | Aerococcus urinae |
| 50 | 1103512 | 1103760 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 51 | 2012141 | 2012386 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 52 | 1553898 | 1554146 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 53 | 1532051 | 1532299 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 54 | 1536516 | 1536764 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 55 | 2486767 | 2487012 | + | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 56 | 1503422 | 1503667 | - | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 57 | 1984689 | 1984955 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 58 | 712951 | 713199 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 59 | 879146 | 879361 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 60 | 1221760 | 1222008 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 61 | 114192 | 114446 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 62 | 765155 | 765400 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 63 | 613795 | 614046 | + | NZ_CP034044.1 | Mycoplasma struthionis |
| 64 | 582889 | 583134 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 65 | 334234 | 334491 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 66 | 1376469 | 1376714 | - | NZ_CP034234.1 | Erysipelothrix piscisicarius |
| 67 | 1032191 | 1032439 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 68 | 378312 | 378557 | - | NZ_CP049889.1 | Jeotgalibaca porci |
| 69 | 219454 | 219714 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 70 | 4965660 | 4965905 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 71 | 2129679 | 2129897 | - | NZ_CP009687.1 | Clostridium aceticum |
| 72 | 2890617 | 2890862 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 73 | 1039972 | 1040217 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 74 | 724650 | 724910 | + | NZ_CP013988.1 | Aerococcus urinaeequi |
| 75 | 869434 | 869703 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 76 | 3907137 | 3907388 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 77 | 2922376 | 2922624 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 78 | 1708251 | 1708496 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 79 | 3277285 | 3277530 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 80 | 1342225 | 1342473 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 81 | 2097284 | 2097529 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 82 | 1472664 | 1472894 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 83 | 2761507 | 2761725 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 84 | 3027549 | 3027794 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 85 | 139509 | 139754 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 86 | 1431576 | 1431821 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 87 | 724805 | 725071 | - | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 88 | 3716 | 3976 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 89 | 124028 | 124273 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 90 | 749763 | 750008 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 91 | 769012 | 769257 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 92 | 762793 | 763038 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 93 | 1575194 | 1575439 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 94 | 3743746 | 3743991 | - | NZ_CP043404.1 | Bacillus safensis |
| 95 | 302035 | 302277 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 96 | 189326 | 189589 | + | NZ_LR214938.2 | Mycoplasma salivarium |
| 97 | 291757 | 292017 | - | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 98 | 1425270 | 1425515 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 99 | 1573996 | 1574214 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 100 | 1262692 | 1262937 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 101 | 1451801 | 1452061 | - | NZ_CP014164.1 | Aerococcus viridans |
| 102 | 1802554 | 1802799 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 103 | 1311529 | 1311774 | + | NZ_LR134439.1 | Erysipelothrix rhusiopathiae |
| 104 | 1097368 | 1097613 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 105 | 1714573 | 1714818 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 106 | 2093043 | 2093285 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 107 | 149719 | 149964 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 108 | 2789376 | 2789621 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 109 | 2066730 | 2066975 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 110 | 1482970 | 1483200 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 111 | 3267210 | 3267455 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 112 | 1102829 | 1103077 | + | NZ_LS483405.1 | Levilactobacillus brevis |
| 113 | 1537934 | 1538209 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 114 | 2385526 | 2385771 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 115 | 1047061 | 1047309 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 116 | 959899 | 960144 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 117 | 1789139 | 1789384 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 118 | 2540574 | 2540819 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 119 | 1406070 | 1406300 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 120 | 691678 | 691953 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 121 | 1460327 | 1460602 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 122 | 985556 | 985828 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 123 | 370838 | 371077 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 124 | 1577708 | 1577953 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 125 | 1949917 | 1950162 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 126 | 894477 | 894725 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 127 | 855402 | 855647 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 128 | 1219096 | 1219341 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 129 | 304954 | 305199 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 130 | 666948 | 667193 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 131 | 1467169 | 1467414 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 132 | 1040747 | 1040992 | - | NZ_CP017326.1 | Weissella soli |
| 133 | 558896 | 559171 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 134 | 2104733 | 2104981 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 135 | 676383 | 676643 | - | NZ_AP014631.1 | Mycoplasma canadense |
| 136 | 2158819 | 2159064 | - | NZ_CP060715.1 | Erysipelothrix inopinata |
| 137 | 34052 | 34288 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 138 | 1628912 | 1629178 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 139 | 494295 | 494558 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 140 | 1180775 | 1181017 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 141 | 2111000 | 2111245 | - | NZ_CP016540.2 | Planococcus versutus |
| 142 | 1562587 | 1562832 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 143 | 1159735 | 1160010 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 144 | 1717648 | 1717863 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 145 | 1040598 | 1040843 | + | NZ_CP014159.1 | Aerococcus christensenii |
| 146 | 1794622 | 1794867 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 147 | 4232745 | 4232990 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 148 | 2200584 | 2200829 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 149 | 3018443 | 3018688 | + | NZ_CP013661.2 | Planococcus kocurii |
| 150 | 2245125 | 2245370 | - | NZ_CP019401.1 | Planococcus faecalis |
| 151 | 1972468 | 1972713 | - | NZ_CP016538.2 | Planococcus maritimus |
| 152 | 1995711 | 1995956 | - | NZ_CP059540.1 | Planococcus maritimus |
| 153 | 1768142 | 1768387 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 154 | 2371951 | 2372196 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 155 | 1230265 | 1230540 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 156 | 2671239 | 2671511 | - | NZ_LS483476.1 | Lederbergia lentus |
| 157 | 1954699 | 1954965 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 158 | 917265 | 917531 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 159 | 1050387 | 1050632 | + | NZ_LR134483.1 | Listeria grayi |
| 160 | 2569073 | 2569318 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 161 | 2591519 | 2591764 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 162 | 1461538 | 1461804 | - | NZ_CP065712.1 | Staphylococcus auricularis |
| 163 | 1047007 | 1047279 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 164 | 1173718 | 1173963 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 165 | 2763568 | 2763813 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 166 | 2700641 | 2700886 | - | NZ_CP019870.1 | Clostridioides difficile |
| 167 | 1659230 | 1659475 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 168 | 93088 | 93363 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 169 | 822070 | 822297 | - | NZ_CP009761.1 | Parvimonas micra |
| 170 | 1305274 | 1305552 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 171 | 1052095 | 1052343 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| 172 | 1704919 | 1705185 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 173 | 747085 | 747300 | + | NZ_CP027563.1 | Weissella confusa |
| 174 | 956778 | 957023 | - | NZ_CP029476.1 | Lactobacillus apis |
| 175 | 1050810 | 1051055 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 176 | 3619485 | 3619730 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 177 | 790741 | 790980 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 178 | 1502814 | 1503062 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 179 | 1421220 | 1421465 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 180 | 2599668 | 2599913 | + | NZ_CP026363.1 | Brevibacillus agri |
| 181 | 1218076 | 1218342 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 182 | 821612 | 821824 | - | NZ_CP029256.1 | Christensenella minuta |
| 183 | 1665643 | 1665918 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 184 | 1727420 | 1727695 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 185 | 857619 | 857894 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 186 | 3743988 | 3744233 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 187 | 890130 | 890405 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 188 | 1457664 | 1457942 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 189 | 1580998 | 1581243 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 190 | 1195850 | 1196095 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 191 | 2262743 | 2262982 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 192 | 1185586 | 1185861 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 193 | 2476360 | 2476608 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 194 | 1609684 | 1609950 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 195 | 543893 | 544138 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 196 | 895383 | 895628 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 197 | 1597923 | 1598171 | - | NZ_LS483306.1 | Enterococcus cecorum |
| 198 | 1303560 | 1303820 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 199 | 1307740 | 1308000 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 200 | 1281762 | 1282022 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 201 | 1419265 | 1419525 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 202 | 3434205 | 3434450 | + | NZ_CP021434.1 | Tumebacillus avium |
| 203 | 1108392 | 1108637 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 204 | 428129 | 428383 | + | NZ_CP031513.1 | Bombilactobacillus bombi |
| 205 | 1011486 | 1011761 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 206 | 2931751 | 2931996 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 207 | 1712062 | 1712337 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 208 | 541258 | 541533 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 209 | 1352827 | 1353072 | + | NZ_CP012024.1 | Bacillus smithii |
| 210 | 946301 | 946546 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 211 | 1309769 | 1310029 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 212 | 2388284 | 2388529 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 213 | 2075785 | 2076054 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 214 | 679720 | 679965 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 215 | 1706633 | 1706908 | + | NZ_CP027770.1 | Staphylococcus felis |
| 216 | 1117729 | 1117959 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 217 | 3401325 | 3401570 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 218 | 822027 | 822245 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 219 | 192551 | 192817 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 220 | 1020204 | 1020452 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 221 | 1776496 | 1776774 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 222 | 1088665 | 1088913 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 223 | 942398 | 942643 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 224 | 1433601 | 1433849 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 225 | 2600807 | 2601052 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 226 | 1604661 | 1604936 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 227 | 2375974 | 2376249 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 228 | 2171952 | 2172197 | + | NZ_CP053989.1 | Niallia circulans |
| 229 | 2341193 | 2341438 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 230 | 1669993 | 1670238 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 231 | 1084351 | 1084617 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 232 | 2881687 | 2881935 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 233 | 2221223 | 2221498 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 234 | 1715734 | 1715973 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 235 | 58499 | 58741 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 236 | 388238 | 388483 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 237 | 938183 | 938428 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 238 | 1653022 | 1653240 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 239 | 1449802 | 1450020 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 240 | 1786397 | 1786615 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 241 | 1022865 | 1023083 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 242 | 1073017 | 1073235 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 243 | 1219060 | 1219320 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 244 | 1068508 | 1068759 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 245 | 1403969 | 1404199 | - | NC_008593.1 | Clostridium novyi NT |
| 246 | 1438092 | 1438325 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 247 | 2293333 | 2293551 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 248 | 2526675 | 2526890 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 249 | 948642 | 948887 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 250 | 1270074 | 1270346 | - | NZ_CP046314.1 | Gemella morbillorum |
| 251 | 932232 | 932504 | + | NZ_LR134484.1 | Gemella haemolysans |
| 252 | 1872404 | 1872622 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 253 | 1120970 | 1121188 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 254 | 1825607 | 1825879 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 255 | 1841454 | 1841726 | - | NZ_LT906444.1 | Listeria welshimeri |
| 256 | 1922044 | 1922316 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 257 | 1867427 | 1867699 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 258 | 668328 | 668579 | + | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 259 | 2300888 | 2301142 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 260 | 1607271 | 1607495 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 261 | 1492753 | 1492998 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 262 | 4299766 | 4299984 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 263 | 1376885 | 1377127 | + | NZ_CP048649.1 | Aminipila butyrica |
| 264 | 1965693 | 1965941 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 265 | 1700403 | 1700702 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 266 | 1439280 | 1439525 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 267 | 1531114 | 1531362 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 268 | 1487224 | 1487442 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 269 | 1545691 | 1545936 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 270 | 1266462 | 1266716 | - | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 271 | 888180 | 888434 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 272 | 861005 | 861223 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 273 | 1185898 | 1186128 | + | NZ_CP020953.1 | Clostridium drakei |
| 274 | 147171 | 147401 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 275 | 2221058 | 2221297 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 276 | 1280297 | 1280530 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 277 | 1276054 | 1276296 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 278 | 1050187 | 1050441 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 279 | 845602 | 845856 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 280 | 1688663 | 1688881 | - | NZ_CP014204.2 | Clostridium baratii |
| 281 | 1156222 | 1156470 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 282 | 2527247 | 2527468 | - | NZ_CP028842.1 | Clostridium botulinum |
| 283 | 2789733 | 2789954 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 284 | 1181299 | 1181544 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 285 | 2673388 | 2673606 | - | NC_014624.2 | Eubacterium callanderi |
| 286 | 3103028 | 3103246 | + | NZ_CP019962.1 | Eubacterium limosum |
| 287 | 2343322 | 2343561 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 288 | 2496563 | 2496781 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 289 | 1278549 | 1278767 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 290 | 2204819 | 2205037 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 291 | 3082079 | 3082309 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 292 | 2211647 | 2211865 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 293 | 188016 | 188234 | - | NZ_CP023671.1 | Clostridium septicum |
| 294 | 1945422 | 1945667 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 295 | 2993856 | 2994140 | - | NC_017243.1 | Brachyspira intermedia PWS/A |
| 296 | 1905122 | 1905367 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 297 | 2546670 | 2546888 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 298 | 613475 | 613741 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 299 | 3094678 | 3094893 | - | NZ_CP014176.1 | Clostridium argentinense |
| 300 | 1713084 | 1713302 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 301 | 2905812 | 2906027 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 302 | 1019081 | 1019341 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 303 | 1536560 | 1536796 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 304 | 1200289 | 1200507 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 305 | 2616832 | 2617071 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 306 | 1822142 | 1822384 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 307 | 1193273 | 1193503 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 308 | 1251201 | 1251467 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 309 | 1879313 | 1879528 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 310 | 1055267 | 1055497 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 311 | 1887996 | 1888214 | - | NZ_HG917868.1 | Clostridium bornimense |
| 312 | 1573868 | 1574086 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 313 | 4233689 | 4233913 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 314 | 1166788 | 1167006 | - | NZ_CP016786.1 | Clostridium isatidis |
| 315 | 1479389 | 1479634 | - | NC_022549.1 | Acholeplasma brassicae |
| 316 | 1090747 | 1090965 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 317 | 579989 | 580216 | - | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 318 | 2647560 | 2647799 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 319 | 2289836 | 2290054 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 320 | 1396417 | 1396635 | + | NZ_CP043998.1 | Clostridium diolis |
| 321 | 1447493 | 1447711 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 322 | 1221728 | 1221970 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 323 | 2250791 | 2251033 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 324 | 1442475 | 1442705 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 325 | 1711296 | 1711538 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 326 | 1442119 | 1442340 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 327 | 1554659 | 1554886 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 328 | 1253411 | 1253653 | + | NZ_LR215050.1 | Acholeplasma hippikon |
| 329 | 1844271 | 1844501 | + | NZ_CP040924.1 | Clostridium thermarum |
| 330 | 1807274 | 1807504 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 331 | 3625484 | 3625714 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 332 | 1389428 | 1389658 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 333 | 3194865 | 3195104 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 334 | 1161472 | 1161690 | + | NZ_CP030775.1 | Clostridium butyricum |
| 335 | 73251 | 73469 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 336 | 774850 | 775065 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 337 | 1351561 | 1351779 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 338 | 2084364 | 2084597 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 339 | 1770172 | 1770462 | - | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
| 340 | 387623 | 387862 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 341 | 1208245 | 1208460 | + | NZ_LN879430.1 | Herbinix luporum |
| 342 | 1228318 | 1228560 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 343 | 3683369 | 3683581 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 344 | 1280337 | 1280555 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 345 | 2101106 | 2101348 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 346 | 1328351 | 1328569 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 347 | 1470522 | 1470764 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 348 | 460019 | 460234 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 349 | 3753667 | 3753885 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 350 | 1243810 | 1244052 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 351 | 2786382 | 2786645 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 352 | 2268505 | 2268720 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 353 | 987832 | 988050 | + | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 354 | 3239323 | 3239541 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 355 | 1289950 | 1290198 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 356 | 2009188 | 2009406 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 357 | 580285 | 580530 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 358 | 1402034 | 1402276 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 359 | 2322839 | 2323078 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 360 | 1305434 | 1305658 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 361 | 2218014 | 2218250 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 362 | 550785 | 551030 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 363 | 1416853 | 1417095 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 364 | 2962791 | 2963009 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 365 | 679163 | 679411 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 366 | 253890 | 254108 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 367 | 705577 | 705813 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 368 | 1338855 | 1339070 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 369 | 2617772 | 2618035 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 370 | 1062206 | 1062451 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 371 | 270274 | 270492 | + | NZ_CP070062.1 | Coprococcus comes |
| 372 | 931685 | 931897 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 373 | 1325418 | 1325636 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 374 | 2232953 | 2233171 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 375 | 2287928 | 2288146 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 376 | 2015703 | 2015921 | - | NZ_CP030280.1 | Blautia argi |
| 377 | 2431562 | 2431780 | + | NZ_CP039126.1 | Blautia producta |
| 378 | 2128840 | 2129058 | - | NZ_LR699011.1 | Roseburia hominis |
| 379 | 1302405 | 1302623 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 380 | 1622207 | 1622425 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 381 | 3136205 | 3136438 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 382 | 2826218 | 2826475 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 383 | 3258745 | 3258960 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 384 | 81771 | 82007 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 385 | 2189792 | 2190046 | - | NZ_CP061799.1 | Desulfonema limicola |
| 386 | 1851910 | 1852155 | + | NC_023035.1 | Salinispira pacifica |
| 387 | 1026830 | 1027072 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 388 | 2310185 | 2310436 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 389 | 1591246 | 1591509 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 390 | 1127275 | 1127487 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 391 | 268653 | 268889 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 392 | 4043633 | 4043866 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 393 | 565975 | 566187 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 394 | 3420292 | 3420552 | + | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 395 | 211932 | 212168 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 396 | 3702075 | 3702329 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 397 | 3746827 | 3747081 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 398 | 322936 | 323175 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 399 | 2619337 | 2619570 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 400 | 1530568 | 1530816 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 401 | 2762661 | 2762912 | - | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 402 | 2207391 | 2207618 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006270.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00448.24 | 0.89 | 357 | 188.0 | same-strand | SRP54-type protein, GTPase domain |
| 2 | PF02881.21 | 0.89 | 357 | 188.0 | same-strand | SRP54-type protein, helical bundle domain |
| 3 | PF04297.16 | 0.79 | 314 | 1491 | same-strand | Putative helix-turn-helix protein, YlxM / p13 like |
| 4 | PF02978.21 | 0.89 | 357 | 117 | same-strand | Signal peptide binding domain |
| 5 | PF13083.8 | 0.81 | 322 | 18.0 | same-strand | KH domain |
| 6 | PF01782.20 | 0.92 | 368 | 349 | same-strand | RimM N-terminal domain |
| 7 | PF05239.18 | 0.9 | 358 | 355.0 | same-strand | PRC-barrel domain |
| 8 | PF01746.23 | 0.94 | 375 | 854 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 9 | PF01245.22 | 0.84 | 334 | 1744.0 | same-strand | Ribosomal protein L19 |
++ More..