Result : Q6KH17
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | AE017308.1 |
| Organism | Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) |
| Left | 772766 |
| Right | 772963 |
| Strand | - |
| Nucleotide Sequence | ATGATGGCAAAGAACAAAATGAAGCCGAAGAAGGCTTTAGCGAAGAGAATTAAAATTTCAAGCACAGGGAAAGTTAAGTTTGGTCATGCTTTTAGATCACACTTAGCACAAAACAAATCAACAAAACAAAAAAGACAATCAAAACACGGAACATTTATGCATCCAACTGATTATAAAAGACTGAAAGATTTAATGTAG |
| Sequence | MMAKNKMKPKKALAKRIKISSTGKVKFGHAFRSHLAQNKSTKQKRQSKHGTFMHPTDYKRLKDLM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 15289470 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6KH17 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 79
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 772766 | 772963 | - | NC_006908.1 | Mycoplasma mobile 163K |
| 2 | 512528 | 512722 | - | NZ_CP007585.1 | Mycoplasma flocculare ATCC 27399 |
| 3 | 224802 | 224996 | - | NZ_CP024161.1 | Mycoplasma dispar |
| 4 | 306653 | 306838 | + | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 5 | 475928 | 476107 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 6 | 202065 | 202244 | + | NZ_AP014631.1 | Mycoplasma canadense |
| 7 | 526897 | 527058 | - | NZ_CP029295.1 | Mycoplasma phocidae |
| 8 | 577192 | 577353 | - | NZ_LS991949.1 | Mycoplasma alkalescens |
| 9 | 421154 | 421315 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 10 | 180836 | 181015 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 11 | 421484 | 421669 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 12 | 700376 | 700555 | - | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 13 | 355721 | 355906 | + | NZ_CP046276.1 | Spiroplasma tabanidicola |
| 14 | 705729 | 705908 | + | NZ_LR214938.2 | Mycoplasma salivarium |
| 15 | 715278 | 715457 | + | NZ_CP029258.1 | Mycoplasmopsis synoviae |
| 16 | 241022 | 241207 | + | NZ_CP017015.1 | Spiroplasma helicoides |
| 17 | 341019 | 341198 | + | NZ_CP030103.1 | Mycoplasma cloacale |
| 18 | 884264 | 884443 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 19 | 291241 | 291441 | + | NZ_CP038013.1 | Spiroplasma gladiatoris |
| 20 | 257659 | 257838 | + | NZ_LR215031.1 | Mycoplasmopsis gallopavonis |
| 21 | 197001 | 197195 | + | NC_021283.1 | Mycoplasma hyopneumoniae 168-L |
| 22 | 620686 | 620865 | + | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 23 | 164663 | 164824 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 24 | 555435 | 555614 | + | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 25 | 96150 | 96329 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
| 26 | 656407 | 656586 | - | NZ_CP034044.1 | Mycoplasma struthionis |
| 27 | 401547 | 401726 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 28 | 564844 | 565026 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 29 | 703641 | 703820 | + | NZ_CP030140.1 | Mycoplasma anseris |
| 30 | 293625 | 293804 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 31 | 349502 | 349681 | - | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 32 | 298103 | 298288 | + | NZ_CP006681.1 | Spiroplasma culicicola AES-1 |
| 33 | 1235098 | 1235283 | - | NZ_CP024870.1 | Spiroplasma clarkii |
| 34 | 358620 | 358799 | - | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 35 | 994858 | 995043 | - | NZ_CP022535.1 | Spiroplasma corruscae |
| 36 | 201078 | 201239 | + | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 37 | 380592 | 380771 | + | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 38 | 303676 | 303861 | + | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 39 | 874261 | 874440 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 40 | 227013 | 227198 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 41 | 232536 | 232703 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 42 | 274607 | 274786 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 43 | 304504 | 304689 | + | NZ_CP024962.1 | Entomoplasma freundtii |
| 44 | 247953 | 248138 | + | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 45 | 261499 | 261684 | + | NZ_CP012622.1 | Spiroplasma cantharicola |
| 46 | 667608 | 667787 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 47 | 1323141 | 1323341 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 48 | 277205 | 277372 | + | NC_022998.1 | Spiroplasma apis B31 |
| 49 | 778937 | 779116 | + | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 50 | 1046704 | 1046889 | - | NZ_CP012328.1 | Spiroplasma turonicum |
| 51 | 796743 | 796922 | + | NZ_CP011368.1 | Mycoplasmopsis canis |
| 52 | 908322 | 908507 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 53 | 400567 | 400746 | + | NZ_LR215042.1 | Mycoplasmopsis meleagridis |
| 54 | 616731 | 616916 | - | NZ_CP024965.1 | Entomoplasma somnilux |
| 55 | 685388 | 685573 | - | NZ_CP025257.1 | Mesoplasma syrphidae |
| 56 | 969500 | 969685 | - | NZ_CP012357.1 | Spiroplasma litorale |
| 57 | 676223 | 676402 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 58 | 121131 | 121310 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 59 | 102281 | 102460 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 60 | 802551 | 802730 | + | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 61 | 519106 | 519285 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 62 | 135715 | 135894 | - | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 63 | 516157 | 516336 | + | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 64 | 952618 | 952818 | + | NC_022549.1 | Acholeplasma brassicae |
| 65 | 970861 | 971046 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 66 | 405393 | 405578 | + | NZ_CP059674.1 | Mycoplasma tullyi |
| 67 | 465737 | 465922 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
| 68 | 218341 | 218526 | + | NC_006055.1 | Mesoplasma florum L1 |
| 69 | 222447 | 222632 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 70 | 222800 | 222985 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
| 71 | 325369 | 325554 | - | NZ_CP024964.1 | Entomoplasma melaleucae |
| 72 | 234128 | 234313 | + | NZ_CP023173.1 | Mesoplasma chauliocola |
| 73 | 1190218 | 1190409 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 74 | 248810 | 248992 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 75 | 267403 | 267585 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 76 | 2698288 | 2698476 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 77 | 2229782 | 2229970 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 78 | 1649834 | 1650025 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 79 | 1719141 | 1719329 | + | NZ_CP020772.1 | Halobacillus mangrovi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006908.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00707.24 | 0.96 | 76 | 27.5 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 2 | PF05198.18 | 0.82 | 65 | 30 | same-strand | Translation initiation factor IF-3, N-terminal domain |
++ More..