Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0473 protein Clos_1662 |
NCBI Accession ID | CP000853.1 |
Organism | Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs)) |
Left | 1761526 |
Right | 1761786 |
Strand | - |
Nucleotide Sequence | ATGGAAGAAAGAGACGACATTATAACACTTTTAGATGAAGAAGGTAAAGAGCAAGATTTTGAGGTAATTATGACTCTTGAAGTAGAAGGAAATGAATATGCGATTTTAGCTCCTGTAGATTCTGATGAAGACGAAGATGCTTATGTATTTAAAATTGTATATGAAAATGAAGACGAATACTCATTAGTGACAATAGAAGATGATGAAGAATATGATAATGTAGTAGCAGCATATGAAACATTAATGGATGAAGAAATGTAA |
Sequence | MEERDDIITLLDEEGKEQDFEVIMTLEVEGNEYAILAPVDSDEDEDAYVFKIVYENEDEYSLVTIEDDEEYDNVVAAYETLMDEEM |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
Pubmed ID | |
Domain | CDD:412983 |
Functional Category | Others |
Uniprot ID | A8MGH9 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1761526 | 1761786 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
2 | 2012205 | 2012471 | + | NZ_CP020559.1 | Clostridium formicaceticum |
3 | 2513840 | 2514103 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
4 | 1867348 | 1867614 | + | NZ_CP009687.1 | Clostridium aceticum |
5 | 1639430 | 1639690 | - | NC_014614.1 | Acetoanaerobium sticklandii |
6 | 5722020 | 5722286 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
7 | 767237 | 767506 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
8 | 1576113 | 1576379 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
9 | 2663532 | 2663819 | - | NZ_CP019870.1 | Clostridioides difficile |
10 | 1254492 | 1254722 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
11 | 1441550 | 1441807 | + | NC_018664.1 | Gottschalkia acidurici 9a |
12 | 2291319 | 2291585 | - | NZ_CP013019.1 | Clostridium pasteurianum |
13 | 863959 | 864207 | + | NZ_LT906477.1 | Clostridium cochlearium |
14 | 1704394 | 1704630 | + | NZ_CP040924.1 | Clostridium thermarum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17770.3 | 1.0 | 14 | 1637.5 | same-strand | Ribonuclease J C-terminal domain |
2 | PF07521.14 | 0.93 | 13 | 1464 | same-strand | Zn-dependent metallo-hydrolase RNA specificity domain |
3 | PF01475.21 | 1.0 | 14 | 120.5 | same-strand | Ferric uptake regulator family |
4 | PF03652.17 | 1.0 | 14 | 73.5 | same-strand | Holliday junction resolvase |
5 | PF06135.14 | 1.0 | 14 | 2881.5 | same-strand | IreB regulatory phosphoprotein |
6 | PF01411.21 | 1.0 | 14 | 3239.0 | same-strand | tRNA synthetases class II (A) |
7 | PF02272.21 | 1.0 | 14 | 3239.0 | same-strand | DHHA1 domain |
8 | PF07973.16 | 1.0 | 14 | 3239.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |