Result : A8MGH9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein Clos_1662 |
| NCBI Accession ID | CP000853.1 |
| Organism | Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs)) |
| Left | 1761526 |
| Right | 1761786 |
| Strand | - |
| Nucleotide Sequence | ATGGAAGAAAGAGACGACATTATAACACTTTTAGATGAAGAAGGTAAAGAGCAAGATTTTGAGGTAATTATGACTCTTGAAGTAGAAGGAAATGAATATGCGATTTTAGCTCCTGTAGATTCTGATGAAGACGAAGATGCTTATGTATTTAAAATTGTATATGAAAATGAAGACGAATACTCATTAGTGACAATAGAAGATGATGAAGAATATGATAATGTAGTAGCAGCATATGAAACATTAATGGATGAAGAAATGTAA |
| Sequence | MEERDDIITLLDEEGKEQDFEVIMTLEVEGNEYAILAPVDSDEDEDAYVFKIVYENEDEYSLVTIEDDEEYDNVVAAYETLMDEEM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | A8MGH9 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1761526 | 1761786 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 2 | 2012205 | 2012471 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 3 | 2513840 | 2514103 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 4 | 1867348 | 1867614 | + | NZ_CP009687.1 | Clostridium aceticum |
| 5 | 1639430 | 1639690 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 6 | 5722020 | 5722286 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 7 | 767237 | 767506 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 8 | 1576113 | 1576379 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 9 | 2663532 | 2663819 | - | NZ_CP019870.1 | Clostridioides difficile |
| 10 | 1254492 | 1254722 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 11 | 1441550 | 1441807 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 12 | 2291319 | 2291585 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 13 | 863959 | 864207 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 14 | 1704394 | 1704630 | + | NZ_CP040924.1 | Clostridium thermarum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009922.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17770.3 | 1.0 | 14 | 1637.5 | same-strand | Ribonuclease J C-terminal domain |
| 2 | PF07521.14 | 0.93 | 13 | 1464 | same-strand | Zn-dependent metallo-hydrolase RNA specificity domain |
| 3 | PF01475.21 | 1.0 | 14 | 120.5 | same-strand | Ferric uptake regulator family |
| 4 | PF03652.17 | 1.0 | 14 | 73.5 | same-strand | Holliday junction resolvase |
| 5 | PF06135.14 | 1.0 | 14 | 2881.5 | same-strand | IreB regulatory phosphoprotein |
| 6 | PF01411.21 | 1.0 | 14 | 3239.0 | same-strand | tRNA synthetases class II (A) |
| 7 | PF02272.21 | 1.0 | 14 | 3239.0 | same-strand | DHHA1 domain |
| 8 | PF07973.16 | 1.0 | 14 | 3239.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..