Result : Q6HMH4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0337 protein BT9727_0908 |
| NCBI Accession ID | AE017355.1 |
| Organism | Bacillus thuringiensis subsp. konkukian (strain 97-27) |
| Left | 1007975 |
| Right | 1008175 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGAGAACGGACTAAAAGAACAAATTACGGGTAAAGTGGAAAAGACAAAGGGACAAGTAAAAGAAGGAATTGGTGAAGTTACAGAAGATAGAAAGTTGAAAAATGAAGGGAAGTGGGACAAGACGAAGGGAACGATAAAAGAAAAAGTCGGAAAAGTGAAACAAAAGATAAGTGATGGGTTGGATAATAAAGAATAA |
| Sequence | MSENGLKEQITGKVEKTKGQVKEGIGEVTEDRKLKNEGKWDKTKGTIKEKVGKVKQKISDGLDNKE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional |
| Pubmed ID | 16621833 |
| Domain | CDD:419889 |
| Functional Category | Others |
| Uniprot ID | Q6HMH4 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 984190 | 984390 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 3395364 | 3395576 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 999678 | 999878 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 4 | 3577376 | 3577588 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 5 | 976476 | 976676 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 6 | 3447987 | 3448199 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 7 | 1006970 | 1007170 | + | NC_011725.1 | Bacillus cereus B4264 |
| 8 | 3658283 | 3658495 | + | NC_011725.1 | Bacillus cereus B4264 |
| 9 | 1746679 | 1746891 | - | NZ_CP040336.1 | Bacillus luti |
| 10 | 6980826 | 6981005 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007530.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11181.10 | 0.67 | 4 | 51.0 | same-strand | Heat induced stress protein YflT |
| 2 | PF04226.15 | 0.67 | 4 | 76.0 | same-strand | Transglycosylase associated protein |
| 3 | PF01740.23 | 0.67 | 4 | 907.5 | same-strand | STAS domain |
| 4 | PF13466.8 | 0.67 | 4 | 907.5 | same-strand | STAS domain |
| 5 | PF13581.8 | 0.67 | 4 | 1252.5 | same-strand | Histidine kinase-like ATPase domain |
| 6 | PF02518.28 | 0.67 | 4 | 1252.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 7 | PF04542.16 | 0.67 | 4 | 1697.5 | same-strand | Sigma-70 region 2 |
| 8 | PF00501.30 | 0.67 | 4 | 2751 | opposite-strand | AMP-binding enzyme |
| 9 | PF13193.8 | 0.67 | 4 | 2751 | opposite-strand | AMP-binding enzyme C-terminal domain |
| 10 | PF09932.11 | 0.67 | 4 | 24.0 | opposite-strand | Uncharacterized conserved protein (DUF2164) |
| 11 | PF01510.27 | 0.83 | 5 | 292 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
| 12 | PF02588.17 | 0.67 | 4 | 1708.0 | same-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 13 | PF10035.11 | 0.67 | 4 | 1708.0 | same-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 14 | PF00903.27 | 0.67 | 4 | 2537.5 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
++ More..