Result : Q6GGH6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | BX571856.1 |
| Organism | Staphylococcus aureus (strain MRSA252) |
| Left | 1674556 |
| Right | 1674786 |
| Strand | - |
| Nucleotide Sequence | ATGACTAAAGAAACGCAAAGTTTTGAAGAAATGATGCAAGAATTAGAGCGAATTGTTCAAAAATTAGATAATGAAACAGTATCTTTAGAGGAATCATTAGATTTATACCAACGTGGTATGAAACTATCAGCAGCTTGTGACACAACTTTAAAAAATGCCGAAAAAAAGGTGAATGACTTAATAAAAGAAGAAGCTGAGGATGTAAAAAATGACGAATCTACCGATGAATAA |
| Sequence | MTKETQSFEEMMQELERIVQKLDNETVSLEESLDLYQRGMKLSAACDTTLKNAEKKVNDLIKEEAEDVKNDESTDE |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 15213324 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q6GGH6 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1542925 | 1543155 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 2 | 1608827 | 1609057 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 3 | 1530372 | 1530602 | - | NZ_LT906460.1 | Staphylococcus simiae |
| 4 | 2001227 | 2001457 | - | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 5 | 1338714 | 1338944 | + | NZ_CP035288.1 | Staphylococcus epidermidis |
| 6 | 1192285 | 1192515 | - | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 7 | 1183358 | 1183561 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 8 | 2041438 | 2041668 | + | NZ_CP033732.1 | Staphylococcus hominis |
| 9 | 461171 | 461410 | - | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 10 | 863886 | 864116 | - | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 11 | 1299007 | 1299237 | + | NZ_LR134242.1 | Staphylococcus warneri |
| 12 | 129924 | 130154 | - | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 13 | 1399567 | 1399797 | + | NZ_AP018587.1 | Staphylococcus caprae |
| 14 | 265072 | 265302 | + | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 15 | 1348915 | 1349151 | + | NZ_CP064056.1 | Staphylococcus lloydii |
| 16 | 576829 | 577029 | + | NZ_CP018199.1 | Staphylococcus succinus |
| 17 | 1410696 | 1410896 | - | NZ_CP013114.1 | Staphylococcus equorum |
| 18 | 1301623 | 1301832 | + | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 19 | 1381051 | 1381239 | + | NZ_CP008724.1 | Staphylococcus xylosus |
| 20 | 1613266 | 1613454 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 21 | 1482517 | 1482708 | + | NZ_CP018776.1 | Staphylococcus condimenti |
| 22 | 1144251 | 1144475 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 23 | 1967291 | 1967482 | - | NZ_CP027770.1 | Staphylococcus felis |
| 24 | 1145487 | 1145711 | - | NZ_CP045927.1 | Staphylococcus agnetis |
| 25 | 1410684 | 1410908 | + | NZ_CP008747.1 | Staphylococcus hyicus |
| 26 | 1201774 | 1201962 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 27 | 1110632 | 1110820 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 28 | 1291559 | 1291783 | - | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 29 | 2509726 | 2509917 | - | NZ_CP020773.1 | Staphylococcus lutrae |
| 30 | 1047381 | 1047569 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 31 | 1434760 | 1434969 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 32 | 2666528 | 2666767 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02463.21 | 0.97 | 31 | 1704 | same-strand | RecF/RecN/SMC N terminal domain |
| 2 | PF13476.8 | 0.97 | 31 | 1704 | same-strand | AAA domain |
| 3 | PF01316.23 | 1.0 | 32 | 1234.5 | same-strand | Arginine repressor, DNA binding domain |
| 4 | PF02863.20 | 1.0 | 32 | 1234.5 | same-strand | Arginine repressor, C-terminal domain |
| 5 | PF00348.19 | 1.0 | 32 | -19.0 | same-strand | Polyprenyl synthetase |
| 6 | PF02601.17 | 1.0 | 32 | -7.0 | same-strand | Exonuclease VII, large subunit |
| 7 | PF13742.8 | 1.0 | 32 | -7.0 | same-strand | OB-fold nucleic acid binding domain |
| 8 | PF01336.27 | 1.0 | 32 | -7.0 | same-strand | OB-fold nucleic acid binding domain |
| 9 | PF01029.20 | 1.0 | 32 | 1349.0 | same-strand | NusB family |
| 10 | PF03780.15 | 0.97 | 31 | 1810 | same-strand | Asp23 family, cell envelope-related function |
| 11 | PF02786.19 | 1.0 | 32 | 2188.5 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 12 | PF00289.24 | 1.0 | 32 | 2188.5 | same-strand | Biotin carboxylase, N-terminal domain |
| 13 | PF02785.21 | 1.0 | 32 | 2188.5 | same-strand | Biotin carboxylase C-terminal domain |
| 14 | PF02222.24 | 0.94 | 30 | 2188.5 | same-strand | ATP-grasp domain |
| 15 | PF02655.16 | 0.88 | 28 | 2194.0 | same-strand | ATP-grasp domain |
| 16 | PF08443.13 | 0.81 | 26 | 2188.5 | same-strand | RimK-like ATP-grasp domain |
| 17 | PF00364.24 | 0.97 | 31 | 3542 | same-strand | Biotin-requiring enzyme |
++ More..