Result : Q6GCI7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Type VII secretion system accessory factor EsaB |
| NCBI Accession ID | BX571857.1 |
| Organism | Staphylococcus aureus (strain MSSA476) |
| Left | 308199 |
| Right | 308441 |
| Strand | + |
| Nucleotide Sequence | ATGAATCAGCACGTAAAAGTAACATTTGATTTTACTAATTATAATTACGGCACATATGACTTAGCAGTACCAGCATATTTACCGATAAAAAACTTAATAGCTTTAGTATTGGATAGTTTGGACATTTCAATATTTGATGTCAATACACAAATTAAAGTGATGACGAAAGGTCAATTACTTGTTGAAAATGATCGACTCATTGATTATCAAATCGCTGATGGAGATATTTTGAAGTTACTATAG |
| Sequence | MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL |
| Source of smORF | Swiss-Prot |
| Function | Seems to regulate secreted factors that contribute to the establishment of persistent infections in the host. {ECO:0000250|UniProtKB:P0C050}. |
| Pubmed ID | 15213324 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | Q6GCI7 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 280141 | 280383 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 2 | 279767 | 280009 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 3 | 2096401 | 2096643 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 4 | 897303 | 897545 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 5 | 2371745 | 2371987 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 6 | 124201 | 124443 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 7 | 1419748 | 1419990 | + | NZ_CP020773.1 | Staphylococcus lutrae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134304.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05257.18 | 1.0 | 7 | 4084 | opposite-strand | CHAP domain |
| 2 | PF06013.14 | 1.0 | 7 | 3600.5 | same-strand | Proteins of 100 residues with WXG |
| 3 | PF18879.2 | 1.0 | 7 | 3550 | same-strand | EspA/EspE family |
| 4 | PF10140.11 | 1.0 | 7 | 13 | same-strand | WXG100 protein secretion system (Wss), protein YukC |
| 5 | PF01580.20 | 1.0 | 7 | 1353 | same-strand | FtsK/SpoIIIE family |
| 6 | PF12538.10 | 1.0 | 7 | 1353 | same-strand | DNA transporter |
| 7 | PF13401.8 | 0.86 | 6 | 1356.5 | same-strand | AAA domain |
| 8 | PF17279.4 | 0.86 | 6 | 5799.0 | same-strand | Family of unknown function (DUF5344) |
| 9 | PF16888.7 | 0.86 | 6 | 6104.0 | same-strand | Domain of unknown function (DUF5082) |
| 10 | PF04740.14 | 0.86 | 6 | 6521.5 | same-strand | LXG domain of WXG superfamily |
++ More..