Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CP000853.1 |
Organism | Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs)) |
Left | 1716982 |
Right | 1717215 |
Strand | - |
Nucleotide Sequence | TTGGAAAGTATTAATTTCGAAGAAACTCTAAAGAAATTAGAAGATGTAGTCCATAAGTTAGAGGTTGAGGAGTTATCCCTAGATGATTCTTTAAAAATATTTGAAGAAGGAATCGGATTATATCGCCAATGTAGCAATGAACTGAATAAAATTGAAAAAAAGATCAGTATCATAATCGAAGAAAATGAAGAATTTAAAAAAGTTCCATTTCCACATGATGAGGAGGAATCGTAA |
Sequence | MESINFEETLKKLEDVVHKLEVEELSLDDSLKIFEEGIGLYRQCSNELNKIEKKISIIIEENEEFKKVPFPHDEEES |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | A8MFJ0 |
ORF Length (Amino Acid) | 77 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1716982 | 1717215 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
2 | 1918979 | 1919170 | + | NZ_CP009687.1 | Clostridium aceticum |
3 | 2161777 | 2162007 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
4 | 2092057 | 2092284 | + | NZ_CP020559.1 | Clostridium formicaceticum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01728.21 | 0.75 | 3 | 4601 | same-strand | FtsJ-like methyltransferase |
2 | PF01479.27 | 0.75 | 3 | 4601 | same-strand | S4 domain |
3 | PF13292.8 | 1.0 | 4 | 2083.5 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
4 | PF02779.26 | 1.0 | 4 | 2083.5 | same-strand | Transketolase, pyrimidine binding domain |
5 | PF02780.22 | 1.0 | 4 | 2083.5 | same-strand | Transketolase, C-terminal domain |
6 | PF02681.16 | 0.75 | 3 | 908 | same-strand | Divergent PAP2 family |
7 | PF00348.19 | 1.0 | 4 | 3.0 | same-strand | Polyprenyl synthetase |
8 | PF13742.8 | 0.75 | 3 | -13 | same-strand | OB-fold nucleic acid binding domain |
9 | PF01336.27 | 0.75 | 3 | -13 | same-strand | OB-fold nucleic acid binding domain |
10 | PF01029.20 | 0.75 | 3 | 2195 | same-strand | NusB family |
11 | PF03780.15 | 0.75 | 3 | 2773 | same-strand | Asp23 family, cell envelope-related function |
12 | PF12685.9 | 0.75 | 3 | 3284 | same-strand | SpoIIIAH-like protein |