Result : Q6FEZ6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | CR543861.1 |
| Organism | Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| Left | 419892 |
| Right | 420098 |
| Strand | - |
| Nucleotide Sequence | ATGAAGGATTTTATAATGCCACGTACATTTCCCTGCCCTCGTTGTGGTCAGCCCTCTGTCTGGGAAGGTAATGAAAGTCGTCCCTTTTGTTCAGAACGCTGCAAACTGATTGATTTGGGTGCTTGGGCCAGTGAAGAATATAAACTCAAAACTCAAGATGCACCAACTTCTGGAAAAGGCCAGCATTCTGACGATTACGAAGATTAA |
| Sequence | MKDFIMPRTFPCPRCGQPSVWEGNESRPFCSERCKLIDLGAWASEEYKLKTQDAPTSGKGQHSDDYED |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 15514110 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q6FEZ6 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 57
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 419892 | 420098 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 2 | 3642650 | 3642844 | + | NZ_CP065820.1 | Acinetobacter seifertii |
| 3 | 1623087 | 1623281 | + | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 4 | 3528546 | 3528740 | + | NZ_CP015121.1 | Acinetobacter baumannii |
| 5 | 3729016 | 3729210 | + | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 6 | 3545679 | 3545873 | + | NZ_CP053391.1 | Acinetobacter lactucae |
| 7 | 3539147 | 3539341 | - | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 8 | 1515214 | 1515408 | + | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 9 | 3038227 | 3038418 | + | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 10 | 2644393 | 2644584 | + | NZ_CP041970.1 | Acinetobacter dispersus |
| 11 | 417752 | 417931 | - | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 12 | 490608 | 490781 | - | NZ_CP029397.2 | Acinetobacter defluvii |
| 13 | 909858 | 910031 | - | NZ_CP071766.1 | Acinetobacter towneri |
| 14 | 428856 | 429041 | - | NZ_CP032134.1 | Acinetobacter chinensis |
| 15 | 4204166 | 4204333 | + | NZ_AP014630.1 | Acinetobacter guillouiae |
| 16 | 462150 | 462350 | + | NZ_CP012808.1 | Acinetobacter equi |
| 17 | 2750874 | 2751059 | + | NZ_CP044483.1 | Acinetobacter schindleri |
| 18 | 349900 | 350085 | - | NZ_CP045650.1 | Acinetobacter wanghuae |
| 19 | 2700378 | 2700584 | + | NZ_CP031222.1 | Aquirhabdus parva |
| 20 | 1321807 | 1321986 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 21 | 1060389 | 1060595 | - | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 22 | 675255 | 675443 | - | NZ_CP012400.2 | Pseudomonas yamanorum |
| 23 | 1192322 | 1192507 | + | NC_014147.1 | Moraxella catarrhalis BBH18 |
| 24 | 2857072 | 2857260 | + | NZ_CP054626.1 | Cupriavidus gilardii |
| 25 | 949977 | 950165 | - | NZ_CP018420.1 | Pseudomonas veronii |
| 26 | 871372 | 871560 | - | NZ_CP027723.1 | Pseudomonas orientalis |
| 27 | 874280 | 874468 | - | NZ_CP010896.1 | Pseudomonas simiae |
| 28 | 1092525 | 1092713 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 29 | 892868 | 893056 | - | NZ_CP023272.1 | Pseudomonas lurida |
| 30 | 5844455 | 5844640 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 31 | 1014529 | 1014717 | - | NZ_CP027756.1 | Pseudomonas synxantha |
| 32 | 5710041 | 5710247 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 33 | 4875833 | 4876033 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 34 | 767040 | 767240 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 35 | 116166 | 116357 | - | NZ_CP012676.1 | Pseudomonas versuta |
| 36 | 1045430 | 1045669 | - | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 37 | 3180231 | 3180416 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 38 | 937781 | 937978 | - | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 39 | 1498700 | 1498894 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 40 | 3557812 | 3558006 | - | NZ_CP033744.1 | Citrobacter freundii |
| 41 | 1052892 | 1053092 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 42 | 2224814 | 2225008 | - | NZ_CP058952.1 | Chitinibacter fontanus |
| 43 | 5382804 | 5383004 | + | NZ_CP029608.1 | Pseudomonas kribbensis |
| 44 | 3822453 | 3822650 | + | NZ_LR134201.1 | Cedecea lapagei |
| 45 | 960928 | 961110 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 46 | 5770617 | 5770823 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 47 | 5187952 | 5188158 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 48 | 5923602 | 5923802 | + | NZ_CP051487.1 | Pseudomonas umsongensis |
| 49 | 5737426 | 5737626 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 50 | 5581672 | 5581872 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 51 | 2587058 | 2587264 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 52 | 829780 | 829980 | - | NZ_CP016210.1 | Azoarcus olearius |
| 53 | 413594 | 413779 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 54 | 5603666 | 5603866 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 55 | 388989 | 389174 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 56 | 3400174 | 3400353 | + | NZ_CP054840.1 | Acidovorax antarcticus |
| 57 | 820983 | 821177 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051298.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01121.22 | 0.63 | 36 | 9.0 | same-strand | Dephospho-CoA kinase |
| 2 | PF00482.25 | 0.61 | 35 | 1498 | same-strand | Type II secretion system (T2SS), protein F |
++ More..