Protein Information |
Information Type | Description |
---|---|
Protein name | PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) |
NCBI Accession ID | CR543861.1 |
Organism | Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
Left | 2461875 |
Right | 2462174 |
Strand | + |
Nucleotide Sequence | TTGGCATCAAAAAGGATTATTAGGATGAGTGACTTATTGCATACCACGCCAGTATTTAATCGCGGTTATCGTTTTCAATGGGAACAAGCCCAGCAATCGTATGTGATTTTGTATCCTGAAGGTTTGGTACGTTTAAATGAAAGCGCAACGCTGATCTTAAAACAGATCGATGGCAAGCTTACTGTGCATGACATCATTCAGAATTTAAGTGCGCAATTTCCAGATGCGACAGGACTCGATCAGGACATCGTAGAGTTTTTAAAACAGGCCGAATCTCGGCAGTGGATTTGCTTGCAATGA |
Sequence | MASKRIIRMSDLLHTTPVFNRGYRFQWEQAQQSYVILYPEGLVRLNESATLILKQIDGKLTVHDIIQNLSAQFPDATGLDQDIVEFLKQAESRQWICLQ |
Source of smORF | Swiss-Prot |
Function | Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway. {ECO:0000255|HAMAP-Rule:MF_00655}. |
Pubmed ID | 15514110 |
Domain | CDD:414309 |
Functional Category | Others |
Uniprot ID | Q6F9J0 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2461875 | 2462174 | + | NC_005966.1 | Acinetobacter baylyi ADP1 |
2 | 2618574 | 2618852 | - | NZ_LT906479.1 | Serratia ficaria |
3 | 3891099 | 3891362 | + | NZ_CP017715.1 | Marinobacter salinus |
4 | 3291808 | 3292071 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
5 | 4195510 | 4195794 | + | NC_014306.1 | Erwinia billingiae Eb661 |
6 | 850808 | 851071 | + | NZ_CP020931.1 | Marinobacter salarius |
7 | 1830715 | 1830993 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
8 | 3964998 | 3965249 | - | NZ_CP065640.1 | Serratia rubidaea |
9 | 330591 | 330869 | + | NZ_CP049115.1 | Pantoea stewartii |
10 | 2577995 | 2578273 | + | NZ_CP071320.1 | Serratia ureilytica |
11 | 952989 | 953237 | + | NZ_CP011835.1 | Azotobacter chroococcum |
12 | 976053 | 976331 | + | NZ_CP038662.1 | Serratia nematodiphila |
13 | 2554994 | 2555272 | - | NZ_CP038662.1 | Serratia nematodiphila |
14 | 3913994 | 3914260 | - | NZ_CP043042.1 | Marinobacter fonticola |
15 | 1398078 | 1398332 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
16 | 2516041 | 2516319 | - | NZ_LR134475.1 | Klebsiella aerogenes |
17 | 1777748 | 1778029 | - | NZ_LR134201.1 | Cedecea lapagei |
18 | 3368068 | 3368346 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
19 | 248799 | 249077 | + | NZ_CP061511.1 | Mixta calida |
20 | 1892369 | 1892632 | + | NZ_CP015581.1 | Tatumella citrea |
21 | 1346463 | 1346741 | - | NZ_CP019706.1 | Pantoea alhagi |
22 | 4053191 | 4053469 | + | NZ_CP028271.1 | Mixta intestinalis |
23 | 74933 | 75190 | + | NZ_CP043869.1 | Neptunomonas concharum |
24 | 269698 | 269973 | + | NZ_CP049136.1 | Paraburkholderia tropica |
25 | 5525797 | 5526054 | + | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
26 | 6242116 | 6242391 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
27 | 6220570 | 6220845 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
28 | 4053195 | 4053488 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
29 | 533635 | 533910 | - | NZ_CP062158.2 | Pseudomonas lundensis |
30 | 2441639 | 2441917 | - | NC_017554.1 | Pantoea ananatis PA13 |
31 | 1350959 | 1351219 | - | NZ_CP038033.1 | Nitrosococcus wardiae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12706.9 | 1.0 | 30 | 765 | same-strand | Beta-lactamase superfamily domain |
2 | PF03070.18 | 1.0 | 30 | 3 | same-strand | TENA/THI-4/PQQC family |
3 | PF04055.23 | 1.0 | 30 | -7 | same-strand | Radical SAM superfamily |
4 | PF13186.8 | 0.93 | 28 | -7 | same-strand | Iron-sulfur cluster-binding domain |