| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | CR543861.1 |
| Organism | Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| Left | 3118182 |
| Right | 3118439 |
| Strand | - |
| Nucleotide Sequence | ATGTCTGAAGAATTGACTTTAGAAGAGCGGAAAGTAATTTATCGTGCACGACGTGGTTTAAAAGAAATTGATGTTTATTTTGATCCTTACGTTAAAAACTATTATTTAACAGCGCCAGCATCAGAAAAAGCCTTATTTGCTGAATTGGTTGCACAGGAAGATCCTGATTTACTGGACTGGTTTATGGAAGTAAGTGAACCACCACAGGTTGAGTTAAAGCAATTGATTCAGAAACTCAAGCATTATGTGCATGGCTAA |
| Sequence | MSEELTLEERKVIYRARRGLKEIDVYFDPYVKNYYLTAPASEKALFAELVAQEDPDLLDWFMEVSEPPQVELKQLIQKLKHYVHG |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | 15514110 |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q6F7U1 |
| ORF Length (Amino Acid) | 85 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3118182 | 3118439 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 2 | 3132132 | 3132389 | - | NZ_CP032134.1 | Acinetobacter chinensis |
| 3 | 2488600 | 2488857 | + | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 4 | 488263 | 488520 | + | NZ_CP065820.1 | Acinetobacter seifertii |
| 5 | 454043 | 454300 | + | NZ_CP015121.1 | Acinetobacter baumannii |
| 6 | 470447 | 470704 | + | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 7 | 421486 | 421743 | + | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 8 | 2405934 | 2406191 | + | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 9 | 3548611 | 3548868 | + | NZ_CP041970.1 | Acinetobacter dispersus |
| 10 | 431389 | 431649 | + | NZ_CP049916.1 | Acinetobacter lanii |
| 11 | 459060 | 459317 | + | NZ_CP053391.1 | Acinetobacter lactucae |
| 12 | 2714931 | 2715188 | - | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 13 | 483199 | 483459 | - | NZ_CP012808.1 | Acinetobacter equi |
| 14 | 184821 | 185078 | - | NZ_CP071766.1 | Acinetobacter towneri |
| 15 | 4136818 | 4137075 | - | NZ_AP014630.1 | Acinetobacter guillouiae |
| 16 | 510848 | 511105 | + | NZ_CP035934.2 | Acinetobacter cumulans |
| 17 | 423894 | 424151 | + | NZ_CP044483.1 | Acinetobacter schindleri |
| 18 | 468005 | 468262 | + | NZ_CP024632.1 | Acinetobacter junii |
| 19 | 560642 | 560899 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 20 | 486845 | 487117 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 21 | 3085763 | 3086023 | - | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 22 | 2350184 | 2350441 | - | NZ_CP045650.1 | Acinetobacter wanghuae |
| 23 | 3519348 | 3519566 | - | NZ_CP031222.1 | Aquirhabdus parva |
| 24 | 1951593 | 1951859 | + | NZ_CP014234.1 | Moraxella osloensis |
| 25 | 2481592 | 2481804 | - | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 26 | 2139806 | 2140087 | - | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 27 | 575618 | 575893 | + | NZ_CP030241.1 | Moraxella bovis |
| 28 | 1409831 | 1410097 | - | NZ_CP011381.2 | Moraxella bovoculi |
| 29 | 649565 | 649831 | + | NZ_CP011158.1 | Moraxella ovis |
| 30 | 1430326 | 1430589 | + | NZ_LR134343.1 | Moraxella cuniculi |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01694.24 | 0.7 | 21 | 2186 | same-strand | Rhomboid family |
| 2 | PF00441.26 | 0.67 | 20 | 187.5 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 3 | PF02771.18 | 0.67 | 20 | 187.5 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
| 4 | PF02770.21 | 0.67 | 20 | 187.5 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 5 | PF08028.13 | 0.67 | 20 | 187.5 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 6 | PF01196.21 | 0.7 | 21 | 3116 | same-strand | Ribosomal protein L17 |