Result : Q6F196
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | AE017263.1 |
| Organism | Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) (Acholeplasma florum) |
| Left | 429523 |
| Right | 429768 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAATATTAAATCACAAAAAAAACGTGTTTTAACTAATGAAAAATCAAGAGCTTCAAATAAAGCAATTAAATCAGAAATTAGAACAGCGATTAAAAAAGCTTTAGCTGCTAAAAAAGATGAAGCTACTGATGCAACAGATTTAATTAATCACGCAGTTAGTTTAGTTGACAAAGGTGTTAAAAAAGGTATCTTAAAACCTAATAAAGCTGCAAGAGAAAAATCACGTTTAATGCAAGCGTAA |
| Sequence | MPNIKSQKKRVLTNEKSRASNKAIKSEIRTAIKKALAAKKDEATDATDLINHAVSLVDKGVKKGILKPNKAAREKSRLMQA |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6F196 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 79
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 429523 | 429768 | + | NC_006055.1 | Mesoplasma florum L1 |
| 2 | 445079 | 445324 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
| 3 | 476944 | 477189 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 4 | 478792 | 479037 | + | NZ_CP024964.1 | Entomoplasma melaleucae |
| 5 | 945932 | 946177 | + | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 6 | 461046 | 461291 | + | NZ_CP023173.1 | Mesoplasma chauliocola |
| 7 | 111125 | 111370 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 8 | 508579 | 508824 | + | NZ_CP025257.1 | Mesoplasma syrphidae |
| 9 | 549506 | 549751 | - | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 10 | 566726 | 566971 | - | NZ_CP031376.1 | Spiroplasma alleghenense |
| 11 | 460946 | 461191 | + | NZ_CP024965.1 | Entomoplasma somnilux |
| 12 | 394580 | 394825 | + | NZ_CP024962.1 | Entomoplasma freundtii |
| 13 | 620334 | 620576 | + | NZ_CP012622.1 | Spiroplasma cantharicola |
| 14 | 485226 | 485468 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 15 | 505818 | 506060 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 16 | 535029 | 535271 | - | NZ_CP022535.1 | Spiroplasma corruscae |
| 17 | 555573 | 555815 | - | NZ_CP012328.1 | Spiroplasma turonicum |
| 18 | 527758 | 528000 | - | NZ_CP012357.1 | Spiroplasma litorale |
| 19 | 700529 | 700774 | - | NZ_CP024963.1 | Entomoplasma luminosum |
| 20 | 568932 | 569174 | - | NC_021846.1 | Spiroplasma taiwanense CT-1 |
| 21 | 305621 | 305866 | + | NZ_CP007520.1 | Mycoplasma yeatsii GM274B |
| 22 | 292594 | 292839 | - | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 23 | 499187 | 499432 | - | NZ_LS991954.1 | Mycoplasma putrefaciens |
| 24 | 688359 | 688601 | + | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 25 | 163937 | 164188 | - | NZ_CP011856.1 | Spiroplasma eriocheiris |
| 26 | 133371 | 133622 | - | NZ_CP002082.1 | Spiroplasma mirum ATCC 29335 |
| 27 | 133377 | 133628 | - | NZ_CP011855.1 | Spiroplasma atrichopogonis |
| 28 | 1305071 | 1305322 | + | NZ_CP010899.1 | Spiroplasma kunkelii CR2-3x |
| 29 | 734179 | 734430 | + | NZ_CP031088.1 | Spiroplasma phoeniceum P40 |
| 30 | 171683 | 171934 | - | NZ_CP013197.1 | Spiroplasma citri |
| 31 | 156818 | 157069 | - | NC_021284.1 | Spiroplasma syrphidicola EA-1 |
| 32 | 134629 | 134880 | - | NC_021280.1 | Spiroplasma chrysopicola DF-1 |
| 33 | 641818 | 642069 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 34 | 1350711 | 1350956 | - | NZ_CP011366.1 | Salinicoccus halodurans |
| 35 | 1316399 | 1316665 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 36 | 2298769 | 2299029 | + | NZ_CP012024.1 | Bacillus smithii |
| 37 | 500774 | 501037 | - | NZ_AP014631.1 | Mycoplasma canadense |
| 38 | 1447468 | 1447722 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 39 | 347695 | 347955 | + | NZ_CP029295.1 | Mycoplasma phocidae |
| 40 | 1594864 | 1595127 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 41 | 784388 | 784648 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 42 | 2659951 | 2660160 | - | NC_015702.1 | Parachlamydia acanthamoebae UV-7 |
| 43 | 683394 | 683657 | + | NZ_CP034044.1 | Mycoplasma struthionis |
| 44 | 757597 | 757851 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 45 | 672534 | 672788 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 46 | 2560201 | 2560467 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 47 | 1790410 | 1790664 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 48 | 2828653 | 2828913 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 49 | 699357 | 699620 | - | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 50 | 1557608 | 1557862 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 51 | 767178 | 767441 | - | NZ_CP009249.1 | Corynebacterium phocae |
| 52 | 267966 | 268220 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 53 | 1022077 | 1022331 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 54 | 725174 | 725428 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 55 | 673411 | 673665 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 56 | 1320667 | 1320939 | + | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 57 | 5305178 | 5305450 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 58 | 703032 | 703286 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 59 | 1734855 | 1735127 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 60 | 3870304 | 3870576 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 61 | 588925 | 589185 | + | NZ_CP042260.1 | Glutamicibacter halophytocola |
| 62 | 1885742 | 1886005 | + | NZ_LR134406.1 | Arachnia propionica |
| 63 | 4501134 | 4501406 | + | NZ_CP009288.1 | Paenibacillus durus |
| 64 | 2128315 | 2128581 | + | NZ_CP033896.1 | Corynebacterium choanae |
| 65 | 12326 | 12589 | - | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 66 | 2010411 | 2010674 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 67 | 3553763 | 3554023 | - | NC_009664.2 | Kineococcus radiotolerans SRS30216 = ATCC BAA-149 |
| 68 | 1845479 | 1845739 | + | NZ_CP033081.1 | Glutamicibacter nicotianae |
| 69 | 5485352 | 5485618 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 70 | 5297975 | 5298247 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 71 | 252082 | 252333 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 72 | 2844367 | 2844639 | - | NZ_CP034437.1 | Paenibacillus albus |
| 73 | 1845735 | 1846007 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 74 | 4717399 | 4717671 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 75 | 3383131 | 3383397 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 76 | 3429591 | 3429857 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 77 | 520044 | 520322 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 78 | 2160845 | 2161099 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 79 | 687235 | 687507 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
++ More..