Result : A8MFA2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000853.1 |
| Organism | Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs)) |
| Left | 1325601 |
| Right | 1325864 |
| Strand | - |
| Nucleotide Sequence | TTGGCAAATATCAAATCTGCACAAAAAAGAATTCTAGTTATCAATAAAAAAACAGCTAGAAATAGAATGATCAAATCTCAACTTAAGACAGCTATCAGAAGATTTGAAGAATCTTTAGCCGCTGGAAACTTTGAAGAAGCAAAAACAAGACTAAAACTTGTTGAAAAGAAACTTCATCAAGCTGCTGCTAAAGGAACTATTCATAAGGCGAAAGCATCTAGAAAAGTTTCTAGACTTGCTACAAAACTTAACAAAGCTATCTAA |
| Sequence | MANIKSAQKRILVINKKTARNRMIKSQLKTAIRRFEESLAAGNFEEAKTRLKLVEKKLHQAAAKGTIHKAKASRKVSRLATKLNKAI |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A8MFA2 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 74
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1325601 | 1325864 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 2 | 2649903 | 2650166 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 3 | 2464086 | 2464349 | + | NZ_CP009687.1 | Clostridium aceticum |
| 4 | 3090325 | 3090588 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 5 | 1943747 | 1944013 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 6 | 1444089 | 1444361 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 7 | 470409 | 470684 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 8 | 2036282 | 2036545 | + | NZ_CP048649.1 | Aminipila butyrica |
| 9 | 1310360 | 1310626 | - | NZ_CP019870.1 | Clostridioides difficile |
| 10 | 617310 | 617576 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 11 | 685994 | 686257 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 12 | 1932889 | 1933158 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 13 | 1911957 | 1912220 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 14 | 1418990 | 1419256 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 15 | 2335015 | 2335281 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 16 | 472908 | 473174 | - | NZ_CP020953.1 | Clostridium drakei |
| 17 | 3774083 | 3774349 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 18 | 5244179 | 5244445 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 19 | 1982122 | 1982385 | + | NZ_CP016786.1 | Clostridium isatidis |
| 20 | 2956820 | 2957086 | + | NZ_CP014176.1 | Clostridium argentinense |
| 21 | 1723165 | 1723431 | + | NC_008593.1 | Clostridium novyi NT |
| 22 | 935173 | 935457 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 23 | 1388144 | 1388407 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 24 | 1778048 | 1778305 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 25 | 895200 | 895466 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 26 | 1195561 | 1195824 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 27 | 1734268 | 1734528 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 28 | 565071 | 565334 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 29 | 1853290 | 1853556 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 30 | 1238471 | 1238737 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 31 | 879717 | 879980 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 32 | 1641457 | 1641717 | + | NZ_HG917868.1 | Clostridium bornimense |
| 33 | 974007 | 974270 | - | NZ_CP043998.1 | Clostridium diolis |
| 34 | 2948989 | 2949252 | + | NZ_CP030775.1 | Clostridium butyricum |
| 35 | 1063696 | 1063980 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 36 | 945760 | 946041 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 37 | 530998 | 531261 | + | NZ_CP023671.1 | Clostridium septicum |
| 38 | 1002107 | 1002370 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 39 | 2053248 | 2053535 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 40 | 3125387 | 3125653 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 41 | 875801 | 876067 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 42 | 1981373 | 1981636 | + | NZ_CP014204.2 | Clostridium baratii |
| 43 | 955400 | 955681 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 44 | 938107 | 938388 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 45 | 2548089 | 2548352 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 46 | 807513 | 807791 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 47 | 1437357 | 1437641 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 48 | 3457402 | 3457668 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 49 | 1007591 | 1007863 | + | NZ_CP027228.1 | Mogibacterium diversum |
| 50 | 2491396 | 2491662 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 51 | 3126925 | 3127191 | + | NZ_CP028842.1 | Clostridium botulinum |
| 52 | 3359032 | 3359298 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 53 | 3284688 | 3284960 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 54 | 1628655 | 1628918 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 55 | 1560839 | 1561102 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 56 | 2402608 | 2402874 | + | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 57 | 1111331 | 1111594 | - | NZ_LN879430.1 | Herbinix luporum |
| 58 | 348241 | 348513 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 59 | 1293178 | 1293444 | - | NZ_CP040924.1 | Clostridium thermarum |
| 60 | 137010 | 137273 | + | NZ_CP071376.1 | Clostridium gasigenes |
| 61 | 2949305 | 2949577 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 62 | 5154317 | 5154589 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 63 | 1228996 | 1229259 | - | NZ_LR699011.1 | Roseburia hominis |
| 64 | 664146 | 664409 | - | NZ_CP029256.1 | Christensenella minuta |
| 65 | 6751188 | 6751460 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 66 | 2463673 | 2463936 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 67 | 966673 | 966936 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 68 | 1085717 | 1085983 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 69 | 902348 | 902620 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 70 | 1314639 | 1314905 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 71 | 2586172 | 2586438 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 72 | 2338140 | 2338403 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 73 | 2486200 | 2486472 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 74 | 622689 | 622949 | - | NZ_CP007490.1 | Rhodoluna lacicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_009922.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03772.18 | 0.84 | 62 | 1121.0 | opposite-strand | Competence protein |
| 2 | PF06144.15 | 0.95 | 70 | 79.5 | opposite-strand | DNA polymerase III, delta subunit |
| 3 | PF07454.13 | 0.64 | 47 | 1369 | opposite-strand | Stage II sporulation protein P (SpoIIP) |
| 4 | PF00009.29 | 0.84 | 62 | 3020 | opposite-strand | Elongation factor Tu GTP binding domain |
| 5 | PF06421.14 | 0.82 | 61 | 3013 | opposite-strand | GTP-binding protein LepA C-terminus |
| 6 | PF00679.26 | 0.84 | 62 | 3015.0 | opposite-strand | Elongation factor G C-terminus |
| 7 | PF03144.27 | 0.84 | 62 | 3020 | opposite-strand | Elongation factor Tu domain 2 |
| 8 | PF01926.25 | 0.81 | 60 | 3020 | opposite-strand | 50S ribosome-binding GTPase |
++ More..