Result : A0LDU6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein Mmc1_3654 |
| NCBI Accession ID | CP000471.1 |
| Organism | Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) |
| Left | 4591624 |
| Right | 4591920 |
| Strand | - |
| Nucleotide Sequence | ATGGGACAACCATCCTGGCAGGGAGATACCCTGCACCTGACCATTCGGGTGCAACCCAAGGCTGCTCAAGAGCGGGTCATGGGTTGGCAGGGTGAGCAGTTAAAAGTTGCCCTTAATGCACCACCGGTGGATGGGGCGGCCAATAAGGCGCTGTGTCATTTTTTAGCCAAACAGTTGGGTATTGCCAAAGGTCAGGTAACGTTGGTAAGGGGGGAGAAATCCCGCGAAAAACAGCTTGTTATTCAAGGTATAAGCCCATCTATATGGCAGCAATTTTTGGAGCGGCATGGCGTGTAA |
| Sequence | MGQPSWQGDTLHLTIRVQPKAAQERVMGWQGEQLKVALNAPPVDGAANKALCHFLAKQLGIAKGQVTLVRGEKSREKQLVIQGISPSIWQQFLERHGV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | 19465526 |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | A0LDU6 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4591624 | 4591920 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 2 | 2773715 | 2773954 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 3 | 3315679 | 3315933 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 4 | 246310 | 246645 | - | NZ_AP018786.1 | Sutterella megalosphaeroides |
| 5 | 749107 | 749361 | - | NZ_CP041247.1 | Raoultella electrica |
| 6 | 894265 | 894522 | + | NZ_CP026047.1 | Raoultella planticola |
| 7 | 800648 | 800902 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 8 | 795489 | 795743 | - | NZ_CP050508.1 | Raoultella terrigena |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014541.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02325.19 | 0.88 | 7 | 33 | same-strand | YGGT family |
| 2 | PF01168.22 | 0.75 | 6 | 617.0 | same-strand | Alanine racemase, N-terminal domain |
| 3 | PF01725.18 | 0.62 | 5 | 13 | same-strand | Ham1 family |
| 4 | PF04055.23 | 0.62 | 5 | 599 | same-strand | Radical SAM superfamily |
| 5 | PF06969.18 | 0.62 | 5 | 599 | same-strand | HemN C-terminal domain |
++ More..