Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0181 protein ECA2377 |
NCBI Accession ID | BX950851.1 |
Organism | Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica) |
Left | 2688125 |
Right | 2688361 |
Strand | - |
Nucleotide Sequence | ATGATTGCAGGTATGCCCGCGCTGACACACAAACAGCAGCAAGATGCCGTAGAGCGCATTCAGGAGTTGATGTCTGAGGGCATGAGCAGTGGACAGGCTATCGCGCTCGTCGCGGCGGAAATTCGCGAAAACCATACGGGTGGCAACGTCGCGATGATGTTTGACGATGACGACATGATTAATGACAGCGATGATGAATATCATTTTGACGATGGTGAGGAAGAGGAAGAGCAGTAA |
Sequence | MIAGMPALTHKQQQDAVERIQELMSEGMSSGQAIALVAAEIRENHTGGNVAMMFDDDDMINDSDDEYHFDDGEEEEEQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22520. Profile Description: Uncharacterized protein family (UPF0181). This family contains small proteins of about 50 amino acids of unknown function. The family includes YoaH. |
Pubmed ID | 15263089 |
Domain | CDD:419844 |
Functional Category | Others |
Uniprot ID | Q6D4L3 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2392238 | 2392474 | + | NZ_CP009125.1 | Pectobacterium atrosepticum |
2 | 2610028 | 2610267 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
3 | 3864975 | 3865223 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
4 | 1082215 | 1082463 | + | NZ_CP017482.1 | Pectobacterium polaris |
5 | 2340375 | 2340614 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
6 | 4062410 | 4062652 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
7 | 1690504 | 1690746 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
8 | 2515742 | 2515981 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
9 | 2000453 | 2000695 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
10 | 1871704 | 1871946 | - | NZ_CP014137.1 | Brenneria goodwinii |
11 | 2426780 | 2426998 | - | NZ_CP050150.1 | Hafnia alvei |
12 | 4725922 | 4726113 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
13 | 4065489 | 4065725 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
14 | 837313 | 837570 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
15 | 921328 | 921585 | - | NZ_CP009787.1 | Yersinia rohdei |
16 | 3665358 | 3665615 | + | NZ_CP007230.1 | Yersinia similis |
17 | 2577993 | 2578250 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
18 | 2020011 | 2020268 | + | NZ_CP011118.1 | Yersinia enterocolitica |
19 | 2555639 | 2555896 | - | NZ_CP046293.1 | Yersinia intermedia |
20 | 2120906 | 2121145 | + | NZ_CP071320.1 | Serratia ureilytica |
21 | 3230647 | 3230904 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
22 | 2041574 | 2041831 | + | NZ_CP043727.1 | Yersinia canariae |
23 | 1497359 | 1497616 | + | NZ_CP032487.1 | Yersinia hibernica |
24 | 1906082 | 1906288 | + | NZ_CP045845.1 | Kluyvera intermedia |
25 | 2468447 | 2468686 | - | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03313.17 | 1.0 | 25 | 2613 | opposite-strand | Serine dehydratase alpha chain |
2 | PF03315.17 | 1.0 | 25 | 2613 | opposite-strand | Serine dehydratase beta chain |
3 | PF00293.30 | 0.88 | 22 | 1577.5 | opposite-strand | NUDIX domain |
4 | PF00425.20 | 1.0 | 25 | 162 | opposite-strand | chorismate binding enzyme |
5 | PF04715.15 | 1.0 | 25 | 162 | opposite-strand | Anthranilate synthase component I, N terminal region |
6 | PF04851.17 | 0.8 | 20 | 1269.5 | same-strand | Type III restriction enzyme, res subunit |
7 | PF03741.18 | 0.76 | 19 | 4175 | same-strand | Integral membrane protein TerC family |
8 | PF03471.19 | 0.76 | 19 | 4175 | same-strand | Transporter associated domain |