Result : Q6BF25
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small toxic polypeptide LdrD |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 3699980 |
| Right | 3700087 |
| Strand | - |
| Nucleotide Sequence | ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGATCGTGAACTGGCTGAACAAGCGGAAGTAA |
| Sequence | MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type I toxin-antitoxin (TA) system. Overexpression causes rapid cell killing and nucleoid condensation of the host cell (Pubmed:12123448). Overexpression induces stress-response and a number of membrane protein genes. May inhibit ATP synthesis due to its insertion in the cell inner membrane (By similarity). {ECO:0000250|UniProtKB:P0DPD0, ECO:0000269|Pubmed:12123448, ECO:0000269|Pubmed:18710431}. |
| Pubmed ID | 9278503 16738553 12123448 18710431 |
| Domain | CDD:404772 |
| Functional Category | Toxin_type_1 |
| Uniprot ID | Q6BF25 |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3699980 | 3700087 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1269703 | 1269810 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1270238 | 1270345 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 1269168 | 1269275 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 3670559 | 3670666 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 3670076 | 3670183 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 7 | 3669593 | 3669700 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 8 | 3671042 | 3671149 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 9 | 2613632 | 2613739 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 10 | 2613149 | 2613256 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 11 | 2612184 | 2612291 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 12 | 2612667 | 2612774 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 13 | 4442251 | 4442358 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 14 | 1715722 | 1715829 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 15 | 1715186 | 1715293 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 16 | 3707248 | 3707355 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 17 | 2433018 | 2433125 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 18 | 2433554 | 2433661 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 19 | 3662788 | 3662895 | - | NZ_AP014857.1 | Escherichia albertii |
| 20 | 4195582 | 4195689 | - | NZ_LR134340.1 | Escherichia marmotae |
| 21 | 4196062 | 4196169 | - | NZ_LR134340.1 | Escherichia marmotae |
| 22 | 2472199 | 2472306 | + | NZ_LR134340.1 | Escherichia marmotae |
| 23 | 2616228 | 2616335 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 24 | 4423880 | 4423987 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 25 | 295674 | 295781 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 26 | 296150 | 296257 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 27 | 298535 | 298642 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 28 | 297580 | 297687 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 29 | 298058 | 298165 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 30 | 210183 | 210290 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 31 | 2443242 | 2443349 | - | NZ_CP033744.1 | Citrobacter freundii |
| 32 | 3808193 | 3808300 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 33 | 242052 | 242159 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 34 | 4505939 | 4506046 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06564.14 | 0.73 | 11 | 3992 | same-strand | Cellulose biosynthesis protein BcsQ |
| 2 | PF01656.25 | 0.73 | 11 | 3992 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF10945.10 | 0.67 | 10 | 3795 | same-strand | Cellulose biosynthesis protein BcsR |
| 4 | PF10995.10 | 0.73 | 11 | 1951.5 | opposite-strand | Cellulose biosynthesis GIL |
| 5 | PF11120.10 | 0.8 | 12 | 1763 | opposite-strand | Cellulose biosynthesis protein BcsF |
| 6 | PF11658.10 | 0.73 | 11 | 87.0 | opposite-strand | Cellulose biosynthesis protein BcsG |
| 7 | PF00005.29 | 0.87 | 13 | 2778.0 | same-strand | ABC transporter |
| 8 | PF08352.14 | 0.8 | 12 | 2778 | same-strand | Oligopeptide/dipeptide transporter, C-terminal region |
| 9 | PF02463.21 | 0.73 | 11 | 2937 | same-strand | RecF/RecN/SMC N terminal domain |
| 10 | PF13614.8 | 0.6 | 9 | 3992 | same-strand | AAA domain |
++ More..