Result : Q6AQK0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CR522870.1 |
| Organism | Desulfotalea psychrophila (strain LSv54 / DSM 12343) |
| Left | 706298 |
| Right | 706582 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATTTCAGAAAAAGAAGTACAACACGTAGCTCATCTTTCACGATTGCACCTTGATCAAGATGAGTTGGCAAGCATGACAGAACAACTTGATGGTATTTTGTCCTATATGGAAAAATTGGCTGAAGTAGATACCGAGGGTGTTCTACCCACAACCCATGCATTTTCTAAAACAAATGCCTTTCGTGAAGATATAGTAAAAGACTCTTTATCTCAGGAAGAATCACTTGCCAATGGTCCTGTGCAAAATGGTACGGCCTTTCAAGTGCCACGAGTTATCTAG |
| Sequence | MKISEKEVQHVAHLSRLHLDQDELASMTEQLDGILSYMEKLAEVDTEGVLPTTHAFSKTNAFREDIVKDSLSQEESLANGPVQNGTAFQVPRVI |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 15305914 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q6AQK0 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 706298 | 706582 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 2 | 1221657 | 1221941 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 3 | 3802034 | 3802321 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 4 | 455926 | 456213 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 5 | 603102 | 603392 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 6 | 5929975 | 5930262 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 7 | 2976270 | 2976557 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 8 | 919751 | 920038 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 9 | 6212618 | 6212905 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 10 | 923529 | 923816 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 11 | 6879669 | 6879956 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 12 | 3718972 | 3719259 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 13 | 683775 | 684062 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 14 | 7170844 | 7171131 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 15 | 5076980 | 5077267 | - | NZ_CP009288.1 | Paenibacillus durus |
| 16 | 4504595 | 4504882 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 17 | 4167556 | 4167843 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 18 | 4283491 | 4283736 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 19 | 2124269 | 2124553 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 20 | 4068413 | 4068700 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 21 | 3090882 | 3091166 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 22 | 2165195 | 2165440 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 23 | 5992959 | 5993246 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 24 | 3529470 | 3529760 | + | NZ_AP021861.1 | Lacipirellula parvula |
| 25 | 880952 | 881239 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 26 | 2153510 | 2153806 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 27 | 938291 | 938524 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 28 | 551541 | 551828 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 29 | 1879288 | 1879575 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 30 | 5621625 | 5621909 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 31 | 956190 | 956477 | + | NZ_CP020028.1 | Paenibacillus kribbensis |
| 32 | 2174313 | 2174615 | - | NZ_CP036281.1 | Polystyrenella longa |
| 33 | 74027 | 74317 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP010311.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01425.23 | 1.0 | 33 | 28 | same-strand | Amidase |
| 2 | PF02934.17 | 0.64 | 21 | 1581 | same-strand | GatB/GatE catalytic domain |
| 3 | PF02637.20 | 0.64 | 21 | 1581 | same-strand | GatB domain |
++ More..