Protein Information |
Information Type | Description |
---|---|
Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
NCBI Accession ID | CR522870.1 |
Organism | Desulfotalea psychrophila (strain LSv54 / DSM 12343) |
Left | 917107 |
Right | 917358 |
Strand | + |
Nucleotide Sequence | ATGGAAGGTAACATTCAACTCGCTCTTATTTGTGTAGGTGCTGCTCTCTCTATTGGACTTGCCGGTCTGGGTGCTGGTATCGGTATTGGTTCCGTTGGACAGGGCGCTTGTATGGGTCTTGCACGTAACCCAGAAGTTCAGCCTAAATTGATGGTTTTCATGATTCTCGGTATGGCTCTTGCTGAGTCTATTGCTATTTACGGACTCGTTATTTCTTTGATTCTTCTCTATGCTAACCCTCTTTTGGGATAG |
Sequence | MEGNIQLALICVGAALSIGLAGLGAGIGIGSVGQGACMGLARNPEVQPKLMVFMILGMALAESIAIYGLVISLILLYANPLLG |
Source of smORF | Swiss-Prot |
Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
Pubmed ID | 15305914 |
Domain | CDD:412393 |
Functional Category | Others |
Uniprot ID | Q6AQ28 |
ORF Length (Amino Acid) | 83 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 917107 | 917358 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
2 | 1865517 | 1865771 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
3 | 3417756 | 3417962 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
4 | 1450485 | 1450745 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
5 | 12493 | 12717 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
6 | 1351950 | 1352174 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
7 | 864975 | 865256 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
8 | 1033167 | 1033427 | + | NZ_CP021255.1 | Desulfobulbus oralis |
9 | 799997 | 800242 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
10 | 2934520 | 2934726 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
11 | 1302996 | 1303247 | + | NC_020127.1 | Lawsonia intracellularis N343 |
12 | 1242911 | 1243192 | + | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
13 | 1485699 | 1485917 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
14 | 756382 | 756591 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
15 | 590138 | 590365 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
16 | 99226 | 99432 | - | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
17 | 495910 | 496116 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
18 | 1180404 | 1180610 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
19 | 1505784 | 1505990 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
20 | 946611 | 946817 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
21 | 2112659 | 2112865 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
22 | 2666194 | 2666421 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
23 | 2258409 | 2258615 | - | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
24 | 832556 | 832762 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
25 | 347834 | 348037 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
26 | 2566334 | 2566558 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
27 | 475921 | 476133 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
28 | 4767697 | 4767909 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
29 | 1661304 | 1661525 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
30 | 4886607 | 4886831 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09527.12 | 0.67 | 20 | 1295.5 | same-strand | Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter |
2 | PF03899.17 | 0.8 | 24 | 896.0 | same-strand | ATP synthase I chain |
3 | PF00119.22 | 0.93 | 28 | 120.5 | same-strand | ATP synthase A chain |