Result : Q6AP69
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L23 |
| NCBI Accession ID | CR522870.1 |
| Organism | Desulfotalea psychrophila (strain LSv54 / DSM 12343) |
| Left | 1273940 |
| Right | 1274227 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAATATATACGGCGTATTAAAGGGGCCTGTCCTCACTGAAAAAGCAGCCATACTTCAAGAGATTGATGGTCAGGTTGTCTTTAAAGTTCATCCTAAATCAAACAAGATAGAGATTAAAAGAGCTATCGAGTTGATGTTTGACGTTAAAGTCAAGGATGTTAGAACTGCGAGTATGCGCGGTAAGGAAAAGCGTGTCGGTAAAACCGTTGGGCAGACTAAAGAGTGGAAGAAAGCCTACGTGTCACTTGCTGAAGGCGAAATTAACTTTACCGATGAGATTTAA |
| Sequence | MKNIYGVLKGPVLTEKAAILQEIDGQVVFKVHPKSNKIEIKRAIELMFDVKVKDVRTASMRGKEKRVGKTVGQTKEWKKAYVSLAEGEINFTDEI |
| Source of smORF | Swiss-Prot |
| Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
| Pubmed ID | 15305914 |
| Domain | CDD:412311 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q6AP69 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 103
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1273940 | 1274227 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 2 | 2316424 | 2316711 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 3 | 1687123 | 1687413 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 4 | 882213 | 882503 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 5 | 495590 | 495871 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 6 | 2422864 | 2423154 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 7 | 1696256 | 1696546 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 8 | 2432320 | 2432601 | - | NZ_AP017372.2 | Halorhodospira halochloris |
| 9 | 3234802 | 3235092 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 10 | 3516643 | 3516879 | - | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 11 | 2916048 | 2916302 | - | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 12 | 925762 | 926034 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 13 | 2464020 | 2464277 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 14 | 2490633 | 2490887 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 15 | 392960 | 393241 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 16 | 595963 | 596196 | + | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 17 | 1574348 | 1574581 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 18 | 1555722 | 1556003 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 19 | 2401798 | 2402049 | + | NC_017856.1 | Methylophaga frappieri |
| 20 | 502312 | 502608 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 21 | 6074945 | 6075235 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 22 | 1081884 | 1082165 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 23 | 1892916 | 1893173 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 24 | 3445380 | 3445676 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 25 | 230762 | 231028 | + | NZ_CP061941.1 | Marinomonas algicola |
| 26 | 1157663 | 1157941 | + | NZ_CP016268.1 | Woeseia oceani |
| 27 | 2344988 | 2345245 | - | NC_014315.1 | Nitrosococcus watsonii C-113 |
| 28 | 1783699 | 1783980 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 29 | 255143 | 255412 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 30 | 4416538 | 4416807 | - | NZ_CP060092.1 | Teredinibacter purpureus |
| 31 | 411397 | 411630 | + | NZ_CP025120.1 | Kangiella profundi |
| 32 | 465448 | 465681 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 33 | 385453 | 385683 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 34 | 2683377 | 2683607 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 35 | 408875 | 409159 | - | NZ_AP021898.1 | Akkermansia muciniphila |
| 36 | 503045 | 503302 | + | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 37 | 2273558 | 2273830 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 38 | 2129582 | 2129815 | - | NZ_CP012418.1 | Kangiella sediminilitoris |
| 39 | 3154773 | 3155045 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
| 40 | 2120865 | 2121098 | - | NZ_CP010975.1 | Kangiella geojedonensis |
| 41 | 416325 | 416645 | + | NZ_CP049916.1 | Acinetobacter lanii |
| 42 | 2210076 | 2210348 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 43 | 1777352 | 1777618 | - | NZ_CP070273.1 | Marinomonas foliarum |
| 44 | 4310691 | 4310957 | - | NZ_CP061081.1 | Marinomonas arctica |
| 45 | 252996 | 253265 | + | NC_015276.1 | Marinomonas mediterranea MMB-1 |
| 46 | 4151898 | 4152218 | - | NZ_AP014630.1 | Acinetobacter guillouiae |
| 47 | 854525 | 854812 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 48 | 3147732 | 3148052 | - | NZ_CP032134.1 | Acinetobacter chinensis |
| 49 | 294223 | 294453 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 50 | 1405097 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 51 | 545588 | 545908 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 52 | 472854 | 473174 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 53 | 494832 | 495152 | + | NZ_CP035934.2 | Acinetobacter cumulans |
| 54 | 2335870 | 2336187 | - | NZ_CP031222.1 | Aquirhabdus parva |
| 55 | 2380748 | 2381038 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 56 | 3681668 | 3681934 | - | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 57 | 495985 | 496305 | - | NZ_CP012808.1 | Acinetobacter equi |
| 58 | 1067670 | 1067954 | - | NZ_LT629973.1 | Akkermansia glycaniphila |
| 59 | 3846420 | 3846686 | - | NZ_CP054301.1 | Marinomonas primoryensis |
| 60 | 3133147 | 3133467 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 61 | 2316960 | 2317244 | - | NZ_CP051774.1 | Luteolibacter luteus |
| 62 | 747808 | 748074 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 63 | 1195284 | 1195562 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 64 | 1655293 | 1655580 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 65 | 988917 | 989177 | - | NZ_CP014234.1 | Moraxella osloensis |
| 66 | 2016035 | 2016304 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 67 | 2590688 | 2590981 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 68 | 2656618 | 2656893 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 69 | 610916 | 611194 | + | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 70 | 2167085 | 2167372 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 71 | 419019 | 419294 | + | NC_016041.1 | Glaciecola nitratireducens FR1064 |
| 72 | 2961768 | 2962055 | - | NZ_CP045875.1 | Heliorestis convoluta |
| 73 | 1670276 | 1670527 | + | NZ_CP031252.1 | Neisseria elongata |
| 74 | 3091526 | 3091801 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 75 | 311308 | 311598 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 76 | 1146789 | 1147040 | + | NZ_LR134313.1 | Neisseria canis |
| 77 | 407386 | 407658 | + | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 78 | 165313 | 165591 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 79 | 491341 | 491625 | - | NZ_CP009228.1 | Treponema putidum |
| 80 | 807774 | 808058 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 81 | 585302 | 585580 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 82 | 2607188 | 2607478 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 83 | 2087093 | 2087365 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 84 | 439308 | 439595 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 85 | 890719 | 890952 | - | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 86 | 1611256 | 1611489 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 87 | 470948 | 471235 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 88 | 463179 | 463466 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 89 | 3634291 | 3634584 | - | NZ_CP033433.1 | Cohnella candidum |
| 90 | 280808 | 281041 | + | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 91 | 2718580 | 2718864 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 92 | 1180184 | 1180438 | - | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 93 | 814223 | 814477 | - | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 94 | 395109 | 395342 | + | NZ_CP016364.1 | Phaeobacter porticola |
| 95 | 1086643 | 1086897 | - | NZ_CP012622.1 | Spiroplasma cantharicola |
| 96 | 229925 | 230176 | + | NZ_CP024870.1 | Spiroplasma clarkii |
| 97 | 2468214 | 2468477 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 98 | 1214034 | 1214303 | - | NC_007618.1 | Brucella abortus 2308 |
| 99 | 1298759 | 1299028 | - | NZ_CP022604.1 | [Ochrobactrum] quorumnocens |
| 100 | 2327740 | 2328030 | - | NZ_CP031700.1 | Neisseria zalophi |
| 101 | 4436270 | 4436533 | + | NZ_CP016616.1 | Microvirga ossetica |
| 102 | 1984884 | 1985120 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 103 | 10122 | 10358 | - | NZ_CP059694.1 | Gordonia rubripertincta |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006138.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00009.29 | 0.71 | 73 | 2104 | same-strand | Elongation factor Tu GTP binding domain |
| 2 | PF03764.20 | 0.61 | 63 | 2937 | same-strand | Elongation factor G, domain IV |
| 3 | PF14492.8 | 0.61 | 63 | 2937 | same-strand | Elongation Factor G, domain III |
| 4 | PF00679.26 | 0.61 | 63 | 2937 | same-strand | Elongation factor G C-terminus |
| 5 | PF03144.27 | 0.71 | 73 | 2104 | same-strand | Elongation factor Tu domain 2 |
| 6 | PF03143.19 | 0.69 | 71 | 1760 | same-strand | Elongation factor Tu C-terminal domain |
| 7 | PF01926.25 | 0.61 | 63 | 1735.5 | same-strand | 50S ribosome-binding GTPase |
| 8 | PF00338.24 | 0.96 | 99 | 1362 | same-strand | Ribosomal protein S10p/S20e |
| 9 | PF00573.24 | 0.95 | 98 | 21.0 | same-strand | Ribosomal protein L4/L1 family |
| 10 | PF03947.20 | 0.94 | 97 | 16 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 11 | PF00181.25 | 0.98 | 101 | 16 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 12 | PF00203.23 | 0.93 | 96 | 870.5 | same-strand | Ribosomal protein S19 |
| 13 | PF00237.21 | 0.96 | 99 | 1160 | same-strand | Ribosomal protein L22p/L17e |
| 14 | PF00189.22 | 0.95 | 98 | 1511.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 15 | PF07650.19 | 0.94 | 97 | 1511 | same-strand | KH domain |
| 16 | PF00252.20 | 0.87 | 90 | 2212.5 | same-strand | Ribosomal protein L16p/L10e |
++ More..