Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | CR522870.1 |
Organism | Desulfotalea psychrophila (strain LSv54 / DSM 12343) |
Left | 3059245 |
Right | 3059466 |
Strand | + |
Nucleotide Sequence | ATGGCAAAAAGAACCTTTGAATCTTCACTGAGCAAACTTGAAAAAATCACAGAAGAACTTGAAAGTGGCGAATTAAGTCTCGAAGGAAGTCTGAAAAAATTCGATGAGGGCATCCAACTCGCCCAGTTCTGCAATGAACAACTTGAAGGGGCCCGGGCAAAGGTAGAAATACTGATGAAAAAAGATGGCAAAGTTCAGGCAGTCCCCTTCGAAGAAGAGTAA |
Sequence | MAKRTFESSLSKLEKITEELESGELSLEGSLKKFDEGIQLAQFCNEQLEGARAKVEILMKKDGKVQAVPFEEE |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 15305914 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q6AJQ3 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3059245 | 3059466 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
2 | 2769988 | 2770236 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
3 | 2804228 | 2804473 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
4 | 8631 | 8879 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
5 | 11718 | 11966 | + | NZ_CP021255.1 | Desulfobulbus oralis |
6 | 1229112 | 1229342 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
7 | 4523369 | 4523611 | + | NZ_CP068551.1 | Pseudomonas khazarica |
8 | 2161777 | 2162007 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
9 | 3324064 | 3324291 | - | NZ_AP023213.1 | Citrifermentans bremense |
10 | 1453142 | 1453369 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
11 | 590293 | 590526 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
12 | 2891853 | 2892083 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
13 | 1980060 | 1980305 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
14 | 1612856 | 1613086 | + | NZ_CP009788.1 | Geobacter pickeringii |
15 | 2537866 | 2538096 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
16 | 2653839 | 2654027 | + | NZ_CP016397.1 | Legionella clemsonensis |
17 | 1015992 | 1016192 | - | NZ_LR134484.1 | Gemella haemolysans |
18 | 670063 | 670254 | - | NZ_CP011104.1 | Photorhabdus thracensis |
19 | 1190174 | 1190374 | + | NZ_CP046314.1 | Gemella morbillorum |
20 | 2104130 | 2104363 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
21 | 3200899 | 3201105 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00348.19 | 0.95 | 20 | 6.5 | same-strand | Polyprenyl synthetase |
2 | PF13292.8 | 0.81 | 17 | 935 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
3 | PF02779.26 | 0.81 | 17 | 935 | same-strand | Transketolase, pyrimidine binding domain |
4 | PF02780.22 | 0.81 | 17 | 935 | same-strand | Transketolase, C-terminal domain |