| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | AE016822.1 |
| Organism | Leifsonia xyli subsp. xyli (strain CTCB07) |
| Left | 648332 |
| Right | 648589 |
| Strand | + |
| Nucleotide Sequence | ATGCTTGTCCTCACCCGGAAACAGGGCGAGAAGATTCTCATCGGCGACGATATCGAGATCACCGTCCTCGACACCCGCGGCGACGGTATCCGCATCGGCATCAGCGCACCCCGGGGCATCCGCATCCAGCGCGACGAAGTGCGCAAGGCGATCGAAGCGGAGAACCGCAGCGCCGCCATGCGGAACCCGGCCGCCGAGTTCGAGCTGATCGCCTCCCTCACCGCTCTCCAGAACGCCGAGGACCCGCCACCGCGCTGA |
| Sequence | MLVLTRKQGEKILIGDDIEITVLDTRGDGIRIGISAPRGIRIQRDEVRKAIEAENRSAAMRNPAAEFELIASLTALQNAEDPPPR |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 15305603 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q6AG99 |
| ORF Length (Amino Acid) | 85 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2197533 | 2197811 | - | NZ_LS483423.1 | Jonesia denitrificans |
| 2 | 924419 | 924661 | + | NZ_CP068013.1 | Paenarthrobacter ureafaciens |
| 3 | 1872745 | 1872990 | - | NZ_CP035494.1 | Microbacterium protaetiae |
| 4 | 1027660 | 1027899 | - | NZ_CP038256.1 | Microbacterium sediminis |
| 5 | 691099 | 691338 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 6 | 2335013 | 2335252 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 7 | 2012582 | 2012821 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 8 | 5105048 | 5105281 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 9 | 439987 | 440214 | + | NZ_CP012024.1 | Bacillus smithii |
| 10 | 1017009 | 1017251 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 11 | 1345723 | 1345962 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 12 | 1309436 | 1309675 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 13 | 4439851 | 4440084 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 14 | 2956793 | 2957044 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 15 | 4090861 | 4091094 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 16 | 994869 | 995120 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 17 | 1221863 | 1222105 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00669.22 | 0.71 | 12 | 1052.0 | same-strand | Bacterial flagellin N-terminal helical region |
| 2 | PF00700.23 | 0.71 | 12 | 1052.0 | same-strand | Bacterial flagellin C-terminal helical region |
| 3 | PF02623.17 | 0.71 | 12 | 2.5 | same-strand | FliW protein |