Result : Q6AFW1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AE016822.1 |
| Organism | Leifsonia xyli subsp. xyli (strain CTCB07) |
| Left | 837682 |
| Right | 837912 |
| Strand | + |
| Nucleotide Sequence | ATGCTCGGTGGCCTCACCGGATGGCATCTGCTCATCATTCTCGCAGTCATCCTGCTCTTGTTCGGCGCGCCGAAGCTTCCCGCTCTGGCCAAGAGCGTCGGGCAGTCCATGCGGATCTTCAAGGGCGAAGTCAACGAGATGAAGAAGGACGGCGATAAGGACAAGGGCGAAGGCGGCAGCACCGCCCCGGCGACCGACACAGGCGCCTCGTCCGAGCAGAACTCCAAGTAA |
| Sequence | MLGGLTGWHLLIILAVILLLFGAPKLPALAKSVGQSMRIFKGEVNEMKKDGDKDKGEGGSTAPATDTGASSEQNSK |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 15305603 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q6AFW1 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1416349 | 1416579 | - | NC_022438.1 | Leifsonia xyli subsp. cynodontis DSM 46306 |
| 2 | 627767 | 627973 | - | NZ_AP017457.1 | Aurantimicrobium minutum |
| 3 | 538670 | 538885 | + | NZ_CP042260.1 | Glutamicibacter halophytocola |
| 4 | 1618033 | 1618251 | + | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 5 | 1874033 | 1874239 | + | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
| 6 | 2296302 | 2296565 | + | NZ_CP013979.1 | Agromyces aureus |
| 7 | 3660068 | 3660316 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 8 | 3479481 | 3479723 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 9 | 1037560 | 1037745 | - | NZ_CP032630.1 | Protaetiibacter intestinalis |
| 10 | 1017085 | 1017282 | - | NZ_CP060716.1 | Leucobacter denitrificans |
| 11 | 1016762 | 1016986 | - | NZ_CP060716.1 | Leucobacter denitrificans |
| 12 | 2253246 | 2253461 | + | NZ_CP038266.1 | Microbacterium wangchenii |
| 13 | 1701341 | 1701592 | + | NZ_CP038266.1 | Microbacterium wangchenii |
| 14 | 123840 | 124052 | - | NZ_CP049934.1 | Leucobacter insecticola |
| 15 | 1957165 | 1957401 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 16 | 3256431 | 3256661 | - | NZ_CP061344.1 | Microbacterium hominis |
| 17 | 1028111 | 1028302 | + | NZ_CP035495.1 | Xylanimonas allomyrinae |
| 18 | 2429777 | 2429968 | + | NZ_CP017146.1 | Marisediminicola antarctica |
| 19 | 1655113 | 1655364 | + | NZ_CP044232.1 | Microbacterium lushaniae |
| 20 | 3219048 | 3219272 | - | NZ_CP032624.1 | Gryllotalpicola protaetiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022438.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08148.14 | 0.83 | 15 | 853 | same-strand | DSHCT (NUC185) domain |
| 2 | PF00270.31 | 0.83 | 15 | 853 | same-strand | DEAD/DEAH box helicase |
| 3 | PF04851.17 | 0.83 | 15 | 853 | same-strand | Type III restriction enzyme, res subunit |
| 4 | PF00902.20 | 0.89 | 16 | 43.5 | same-strand | Sec-independent protein translocase protein (TatC) |
| 5 | PF19187.2 | 0.83 | 15 | 81 | same-strand | PafC helix-turn-helix domain |
| 6 | PF13280.8 | 0.83 | 15 | 405 | same-strand | WYL domain |
++ More..