Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AE016822.1 |
Organism | Leifsonia xyli subsp. xyli (strain CTCB07) |
Left | 1744389 |
Right | 1744667 |
Strand | + |
Nucleotide Sequence | ATGGATGCCATGCCACTCTCCGATATCAGCGCGCTCGGCTACGAGGAGGCGCGCGACGAACTCGTCCGCGTCGTCACCGAGCTGGAGCAGGGCTCCGCGACGCTCGAGGAGTCCCTCGCGCTCTGGGAGCGCGGCGAAGCTCTGGCCCGGCGCTGCGAGGAGTGGCTGATCGGTGCGAAGGCCCGGCTCGACGCCGCGCGCGCCGGGGCCGCAGAGAGCGCGGGCACGGCAAAAAGCGCGGTCGCGGCGGACAGCAGGGGAGCCGCGGACAGCGCATGA |
Sequence | MDAMPLSDISALGYEEARDELVRVVTELEQGSATLEESLALWERGEALARRCEEWLIGAKARLDAARAGAAESAGTAKSAVAADSRGAADSA |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 15305603 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | Q6ADU8 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1827280 | 1827540 | + | NC_022438.1 | Leifsonia xyli subsp. cynodontis DSM 46306 |
2 | 1644359 | 1644625 | - | NZ_CP013979.1 | Agromyces aureus |
3 | 1169136 | 1169381 | + | NZ_CP035806.1 | Leucobacter triazinivorans |
4 | 983427 | 983657 | + | NZ_AP017457.1 | Aurantimicrobium minutum |
5 | 1457564 | 1457803 | + | NZ_CP014209.1 | Isoptericola dokdonensis DS-3 |
6 | 1200899 | 1201147 | - | NZ_CP031425.1 | Microbacterium foliorum |
7 | 1251638 | 1251919 | - | NZ_CP045529.1 | Luteimicrobium xylanilyticum |
8 | 2528656 | 2528886 | + | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
9 | 1360421 | 1360654 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
10 | 2800104 | 2800337 | + | NZ_CP023692.1 | Streptomyces vinaceus |
11 | 2869729 | 2869965 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
12 | 1979678 | 1979905 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
13 | 4065370 | 4065612 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
14 | 3057038 | 3057286 | + | NZ_CP060404.1 | Streptomyces buecherae |
15 | 1292798 | 1293031 | - | NZ_CP016174.1 | Amycolatopsis orientalis |
16 | 889641 | 889871 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
17 | 833684 | 833986 | - | NZ_CP039292.1 | Actinomyces procaprae |
18 | 809801 | 810040 | - | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
19 | 1224896 | 1225141 | - | NZ_AP017369.1 | Corynebacterium suranareeae |
20 | 1801003 | 1801281 | + | NZ_CP009249.1 | Corynebacterium phocae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02401.20 | 0.9 | 18 | 1754.0 | opposite-strand | LytB protein |
2 | PF13742.8 | 0.95 | 19 | 32 | same-strand | OB-fold nucleic acid binding domain |
3 | PF14030.8 | 0.65 | 13 | 4 | opposite-strand | Protein of unknown function (DUF4245) |
4 | PF01336.27 | 0.6 | 12 | 53.0 | same-strand | OB-fold nucleic acid binding domain |