Result : Q6ABV4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | AE016822.1 |
| Organism | Leifsonia xyli subsp. xyli (strain CTCB07) |
| Left | 2583068 |
| Right | 2583325 |
| Strand | - |
| Nucleotide Sequence | GTGCTCCGGGGATACCGAGCCGTTTTCTCTCCGTTCTACGGGGATGTCTGCCGCTACTATCCATCGTGTTCCGCCTATACCTTGCAGGCTGTGCAGGAGCACGGAGTGATCTTCGGCGGATACCTCGGCGTGTGCCGTATCCTCCGCTGCCATCCGTGGGCAGCGGGCGGAGTCGATGATGTCCCTCTTCGGGGGAAGCGCCGCTATCGGATGACCGCGTTCGGTTTCGTCGTCGCCACCAGCCAGGGAAAGGCCTAG |
| Sequence | MLRGYRAVFSPFYGDVCRYYPSCSAYTLQAVQEHGVIFGGYLGVCRILRCHPWAAGGVDDVPLRGKRRYRMTAFGFVVATSQGKA |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 15305603 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q6ABV4 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2685327 | 2685584 | - | NC_022438.1 | Leifsonia xyli subsp. cynodontis DSM 46306 |
| 2 | 4060358 | 4060594 | - | NZ_CP020715.1 | Cnuibacter physcomitrellae |
| 3 | 2472806 | 2473051 | + | NZ_CP030033.1 | Cryobacterium soli |
| 4 | 4173389 | 4173634 | - | NZ_CP016282.1 | Cryobacterium arcticum |
| 5 | 3270580 | 3270816 | - | NZ_CP033724.1 | Clavibacter michiganensis subsp. michiganensis |
| 6 | 3160229 | 3160483 | - | NZ_CP026949.1 | Mycetocola zhujimingii |
| 7 | 4218600 | 4218854 | - | NZ_CP047180.1 | Rathayibacter festucae |
| 8 | 2584393 | 2584644 | - | NZ_CP058670.1 | Chryseoglobus indicus |
| 9 | 1456350 | 1456616 | - | NZ_CP049255.1 | Microbacterium endophyticum |
| 10 | 3212727 | 3213002 | - | NZ_CP047186.1 | Rathayibacter tanaceti |
| 11 | 2831746 | 2832054 | + | NZ_CP028129.1 | Rathayibacter rathayi |
| 12 | 2615005 | 2615313 | - | NZ_CP028130.1 | Rathayibacter iranicus |
| 13 | 3353401 | 3353709 | - | NZ_CP015515.1 | Rathayibacter tritici |
| 14 | 1648744 | 1648998 | + | NZ_CP049253.1 | Microbacterium amylolyticum |
| 15 | 2791027 | 2791233 | - | NZ_CP038256.1 | Microbacterium sediminis |
| 16 | 2995768 | 2995974 | - | NZ_CP031421.1 | Microbacterium oleivorans |
| 17 | 1423131 | 1423361 | - | NZ_CP040508.1 | Rhodoluna limnophila |
| 18 | 1426777 | 1427037 | - | NZ_CP035494.1 | Microbacterium protaetiae |
| 19 | 3905809 | 3906027 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 20 | 1436264 | 1436512 | + | NZ_AP017457.1 | Aurantimicrobium minutum |
| 21 | 3566987 | 3567193 | - | NZ_CP031425.1 | Microbacterium foliorum |
| 22 | 1429278 | 1429523 | - | NZ_CP007490.1 | Rhodoluna lacicola |
| 23 | 3827134 | 3827340 | - | NZ_CP038266.1 | Microbacterium wangchenii |
| 24 | 3649048 | 3649254 | - | NZ_CP044232.1 | Microbacterium lushaniae |
| 25 | 3261590 | 3261841 | - | NZ_CP044231.1 | Microbacterium caowuchunii |
| 26 | 3295632 | 3295838 | - | NZ_CP064760.1 | Microbacterium schleiferi |
| 27 | 4263774 | 4264022 | - | NZ_CP019239.1 | Rhodoferax saidenbachensis |
| 28 | 2753891 | 2754112 | - | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 29 | 3554638 | 3554934 | - | NZ_CP031423.1 | Microbacterium lemovicicum |
| 30 | 3958035 | 3958268 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 31 | 3306726 | 3306965 | - | NC_015588.1 | Isoptericola variabilis 225 |
| 32 | 1636150 | 1636392 | + | NZ_CP038436.1 | Nocardioides seonyuensis |
| 33 | 3643114 | 3643320 | - | NZ_CP019038.1 | Massilia putida |
| 34 | 769 | 996 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 35 | 2430509 | 2430733 | - | NZ_CP015093.1 | Salipiger abyssi |
| 36 | 404778 | 405020 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 37 | 3805463 | 3805684 | - | NZ_CP026734.1 | Brevibacterium linens |
| 38 | 6862151 | 6862366 | - | NZ_CP030862.1 | Streptomyces globosus |
| 39 | 2667108 | 2667326 | + | NZ_CP014209.1 | Isoptericola dokdonensis DS-3 |
| 40 | 1767267 | 1767494 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 41 | 3766995 | 3767255 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 42 | 2842307 | 2842519 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 43 | 661155 | 661397 | - | NZ_LR134363.1 | Actinomyces slackii |
| 44 | 11271883 | 11272143 | - | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 45 | 1182646 | 1182879 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 46 | 2358296 | 2358514 | - | NZ_CP020468.1 | Actinomyces gaoshouyii |
| 47 | 3008160 | 3008390 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 48 | 285190 | 285408 | - | NZ_CP029176.1 | Acidibrevibacterium fodinaquatile |
| 49 | 2563149 | 2563394 | - | NZ_CP066802.1 | Actinomyces weissii |
| 50 | 284287 | 284529 | - | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033724.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02195.20 | 0.6 | 30 | 3426.5 | same-strand | ParB-like nuclease domain |
| 2 | PF17762.3 | 0.6 | 30 | 3426.5 | same-strand | HTH domain found in ParB protein |
| 3 | PF13614.8 | 0.7 | 35 | 2531 | same-strand | AAA domain |
| 4 | PF01656.25 | 0.7 | 35 | 2531 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 5 | PF06564.14 | 0.66 | 33 | 2471 | same-strand | Cellulose biosynthesis protein BcsQ |
| 6 | PF01424.24 | 0.78 | 39 | 1071 | same-strand | R3H domain |
| 7 | PF02096.22 | 0.96 | 48 | 7.0 | same-strand | 60Kd inner membrane protein |
| 8 | PF00468.19 | 0.86 | 43 | 447 | same-strand | Ribosomal protein L34 |
| 9 | PF02527.17 | 0.76 | 38 | 1662.0 | same-strand | rRNA small subunit methyltransferase G |
++ More..