Result : A8LH55
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier) |
| NCBI Accession ID | CP000820.1 |
| Organism | Frankia sp. (strain EAN1pec) |
| Left | 5854061 |
| Right | 5854279 |
| Strand | - |
| Nucleotide Sequence | ATGGCCCAGAGGGACACCGGTGGCGGGCAGCAGCGCACCGGCCGCCGTGATGACGAGACCGCCGAGGCCGAGGTTGAGGAATCGGGCGCCTCGGATCTCAAGGAAAGGCACGAGAAGCTCTCGGAGGACGTCGACTCCCTGCTCGACGAAATCGATGACGTTCTCGAGGAGAACGCCGAGGAGTTCGTGAAGGGATACGTCCAGAAGGGCGGTCAGTAG |
| Sequence | MAQRDTGGGQQRTGRRDDETAEAEVEESGASDLKERHEKLSEDVDSLLDEIDDVLEENAEEFVKGYVQKGGQ |
| Source of smORF | Swiss-Prot |
| Function | Protein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation. {ECO:0000255|HAMAP-Rule:MF_02106}. |
| Pubmed ID | 17151343 |
| Domain | CDD:391659 |
| Functional Category | Others |
| Uniprot ID | A8LH55 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 171
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3101414 | 3101632 | - | NC_007777.1 | Frankia casuarinae |
| 2 | 3108611 | 3108829 | + | NC_008278.1 | Frankia alni ACN14a |
| 3 | 7657113 | 7657331 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 4 | 1608901 | 1609119 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 5 | 7882904 | 7883122 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 6 | 6412601 | 6412819 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 7 | 4586694 | 4586909 | - | NC_014666.1 | Frankia inefficax |
| 8 | 2043229 | 2043447 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 9 | 1790599 | 1790817 | - | NZ_CP022685.1 | Streptomyces formicae |
| 10 | 506741 | 506959 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 11 | 8047864 | 8048082 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 12 | 2355372 | 2355590 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 13 | 3142730 | 3142948 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 14 | 1832747 | 1832965 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 15 | 1884204 | 1884422 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 16 | 1033566 | 1033784 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 17 | 1058551 | 1058769 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 18 | 1156830 | 1157048 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 19 | 1466300 | 1466518 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 20 | 6931462 | 6931680 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 21 | 2804048 | 2804266 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 22 | 400426 | 400644 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 23 | 5955821 | 5956039 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 24 | 2004246 | 2004464 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 25 | 1648061 | 1648276 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 26 | 1455594 | 1455812 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 27 | 8124428 | 8124643 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 28 | 7893733 | 7893951 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 29 | 1263912 | 1264130 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 30 | 2364640 | 2364858 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 31 | 7601197 | 7601415 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 32 | 957628 | 957846 | - | NZ_CP031194.1 | Streptomyces paludis |
| 33 | 6826642 | 6826860 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 34 | 1950003 | 1950221 | - | NZ_CP027306.1 | Streptomyces atratus |
| 35 | 1317335 | 1317553 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 36 | 7337856 | 7338074 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 37 | 1292262 | 1292480 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 38 | 1350545 | 1350763 | - | NZ_CP029043.1 | Streptomyces nigra |
| 39 | 1492399 | 1492617 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 40 | 7047703 | 7047921 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 41 | 7519643 | 7519861 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 42 | 2082111 | 2082329 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 43 | 2626705 | 2626923 | - | NZ_CP070326.1 | Streptomyces noursei |
| 44 | 1547579 | 1547797 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 45 | 1761799 | 1762017 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 46 | 8127102 | 8127320 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 47 | 7992097 | 7992315 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 48 | 7720045 | 7720263 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 49 | 1418012 | 1418230 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 50 | 2239900 | 2240118 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 51 | 1751656 | 1751874 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 52 | 2117769 | 2117978 | - | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 53 | 6703731 | 6703949 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 54 | 1238785 | 1239003 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 55 | 5985692 | 5985910 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 56 | 7018327 | 7018545 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 57 | 1094824 | 1095042 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 58 | 1179723 | 1179941 | - | NZ_CP070242.1 | Streptomyces californicus |
| 59 | 1167718 | 1167936 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 60 | 1154682 | 1154900 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 61 | 6860667 | 6860885 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 62 | 2331666 | 2331884 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 63 | 7633988 | 7634203 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 64 | 1377558 | 1377776 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 65 | 1382102 | 1382320 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 66 | 1078923 | 1079141 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 67 | 1976421 | 1976639 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 68 | 2711211 | 2711429 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 69 | 5795867 | 5796085 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 70 | 1441133 | 1441351 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 71 | 2789905 | 2790114 | + | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 72 | 1824501 | 1824719 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 73 | 6166746 | 6166964 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 74 | 5934666 | 5934878 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 75 | 6862140 | 6862358 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 76 | 6506436 | 6506651 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 77 | 6445127 | 6445336 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 78 | 5867901 | 5868113 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 79 | 6362012 | 6362230 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 80 | 2428074 | 2428286 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 81 | 4878648 | 4878860 | - | NZ_CP030862.1 | Streptomyces globosus |
| 82 | 1575944 | 1576162 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 83 | 1358589 | 1358801 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 84 | 1751478 | 1751690 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 85 | 1320846 | 1321061 | + | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 86 | 1645734 | 1645946 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 87 | 1849868 | 1850086 | - | NZ_CP023691.1 | Streptomyces platensis |
| 88 | 5585342 | 5585557 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 89 | 4886223 | 4886438 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 90 | 1799716 | 1799928 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 91 | 6615423 | 6615641 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 92 | 6910621 | 6910830 | - | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 93 | 9380708 | 9380926 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 94 | 5736053 | 5736268 | - | NC_022657.1 | Actinoplanes friuliensis DSM 7358 |
| 95 | 5699989 | 5700204 | - | NC_017093.1 | Actinoplanes missouriensis 431 |
| 96 | 6236351 | 6236569 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 97 | 2744706 | 2744915 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 98 | 5885434 | 5885652 | + | NC_020990.1 | Streptomyces albidoflavus |
| 99 | 2537363 | 2537578 | + | NC_009380.1 | Salinispora tropica CNB-440 |
| 100 | 195067 | 195270 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 101 | 3450716 | 3450931 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 102 | 4366405 | 4366620 | + | NZ_CP058322.1 | Micromonospora carbonacea |
| 103 | 766852 | 767064 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 104 | 538222 | 538434 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 105 | 2698238 | 2698447 | + | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 106 | 1546355 | 1546561 | + | NZ_CP045309.1 | Micromonospora terminaliae |
| 107 | 6057547 | 6057762 | + | NZ_CP061725.1 | Micromonospora craniellae |
| 108 | 1898602 | 1898802 | - | NZ_CP011502.1 | Aeromicrobium erythreum |
| 109 | 2991344 | 2991547 | + | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 110 | 2744710 | 2744907 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 111 | 3367788 | 3367982 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 112 | 730393 | 730602 | + | NZ_CP043661.1 | Kribbella qitaiheensis |
| 113 | 2657522 | 2657716 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 114 | 3443758 | 3443967 | + | NC_013729.1 | Kribbella flavida DSM 17836 |
| 115 | 1314461 | 1314676 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 116 | 1826828 | 1827022 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 117 | 3852625 | 3852840 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 118 | 2033148 | 2033342 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 119 | 6031563 | 6031760 | - | NZ_CP041146.1 | Nocardioides humi |
| 120 | 1686207 | 1686401 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 121 | 10078472 | 10078690 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 122 | 2919572 | 2919787 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 123 | 3310826 | 3311017 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 124 | 3567166 | 3567357 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 125 | 4538783 | 4538998 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 126 | 1923821 | 1924015 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 127 | 1209705 | 1209899 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 128 | 4390548 | 4390763 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 129 | 3460443 | 3460658 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 130 | 5110448 | 5110663 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 131 | 2493184 | 2493378 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 132 | 4760115 | 4760330 | - | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 133 | 1162290 | 1162505 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 134 | 2429837 | 2430034 | + | NZ_CP059164.1 | Nocardioides ungokensis |
| 135 | 4226807 | 4227001 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 136 | 2163162 | 2163359 | + | NZ_CP049257.1 | Nocardioides anomalus |
| 137 | 2370598 | 2370813 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 138 | 2424517 | 2424732 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 139 | 403838 | 404035 | + | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 140 | 3145826 | 3146020 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 141 | 3353109 | 3353303 | + | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 142 | 1138901 | 1139098 | + | NZ_CP041091.1 | Nocardioides sambongensis |
| 143 | 5032284 | 5032478 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 144 | 4028184 | 4028378 | + | NZ_AP017900.1 | Nocardia seriolae |
| 145 | 4712812 | 4713006 | - | NZ_LR134352.1 | Nocardia asteroides |
| 146 | 2573589 | 2573783 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 147 | 961867 | 962061 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 148 | 3249731 | 3249925 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 149 | 6373186 | 6373404 | + | NZ_CP022310.1 | Streptomyces calvus |
| 150 | 5530214 | 5530432 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 151 | 2426057 | 2426251 | + | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 152 | 2892428 | 2892625 | - | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 153 | 2630730 | 2630921 | + | NZ_CP029146.1 | Rhodococcus ruber |
| 154 | 3499602 | 3499796 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 155 | 1051050 | 1051247 | - | NZ_CP044344.1 | Nocardioides cynanchi |
| 156 | 935731 | 935922 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 157 | 504690 | 504878 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 158 | 90937 | 91134 | - | NZ_LT828648.1 | Nitrospira japonica |
| 159 | 355395 | 355592 | - | NC_009664.2 | Kineococcus radiotolerans SRS30216 = ATCC BAA-149 |
| 160 | 2232282 | 2232473 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 161 | 1661360 | 1661557 | - | NZ_CP013290.1 | Janibacter indicus |
| 162 | 2229673 | 2229867 | - | NC_014151.1 | Cellulomonas flavigena DSM 20109 |
| 163 | 1997883 | 1998089 | + | NC_014830.1 | Intrasporangium calvum DSM 43043 |
| 164 | 1538249 | 1538443 | - | NZ_CP015622.1 | Corynebacterium crudilactis |
| 165 | 1710006 | 1710200 | - | NZ_AP017369.1 | Corynebacterium suranareeae |
| 166 | 1318909 | 1319103 | + | NZ_CP009247.1 | Corynebacterium frankenforstense DSM 45800 |
| 167 | 1788916 | 1789101 | + | NZ_CP033081.1 | Glutamicibacter nicotianae |
| 168 | 1166412 | 1166594 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 169 | 1749441 | 1749641 | - | NZ_CP044427.1 | Ornithinimicrobium pratense |
| 170 | 1875496 | 1875699 | - | NZ_CP051884.1 | Cellulomonas taurus |
| 171 | 3474572 | 3474769 | - | NZ_CP015079.1 | Nocardioides dokdonensis FR1436 |
| 172 | 1589382 | 1589564 | + | NC_014168.1 | Segniliparus rotundus DSM 44985 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007777.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00227.28 | 0.95 | 162 | 831.0 | same-strand | Proteasome subunit |
| 2 | PF03136.17 | 0.98 | 167 | 191.0 | same-strand | Pup-ligase protein |
| 3 | PF00004.31 | 0.86 | 147 | 1935 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF17758.3 | 0.86 | 147 | 1935 | same-strand | Proteasomal ATPase OB N-terminal domain |
| 5 | PF16450.7 | 0.86 | 147 | 1935 | same-strand | Proteasomal ATPase OB C-terminal domain |
| 6 | PF13459.8 | 0.6 | 103 | 3945 | opposite-strand | 4Fe-4S single cluster domain |
| 7 | PF13370.8 | 0.6 | 103 | 3945 | opposite-strand | 4Fe-4S single cluster domain of Ferredoxin I |
| 8 | PF14801.8 | 0.7 | 119 | 5105 | same-strand | tRNA methyltransferase complex GCD14 subunit N-term |
++ More..