Result : Q67QG6

Protein Information

• Protein name: 50S ribosomal protein L35
• NCBI Accession ID: AP006840.1
• Organism: Symbiobacterium thermophilum (strain T / IAM 14863)
• Left: 1211641
• Right: 1211835
• Strand: +
• Nucleotide Sequence: ATGCCGAAGATGAAGTCCCATCGCGGCGCTGCCAAGCGGTTCAAGCTGACCGGCAGCGGCCTGGTGAAGCATTACCCCAGCAACAAGCACCACAAGAACACCCACAAGAAGGAGAACAGGATCCGCGCCCTGAAGCGCAACCTCGTCCTGTCCAAGTCCTTCCAGAAGAACATCCGGGAGATTCTGCCCCACTAA
• Sequence: MPKMKSHRGAAKRFKLTGSGLVKHYPSNKHHKNTHKKENRIRALKRNLVLSKSFQKNIREILPH
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification]
• Pubmed ID: 15383646
• Domain: CDD:412354
• Functional Category: Ribosomal_protein
• Uniprot ID: Q67QG6
• ORF Length (Amino Acid): 64

Conservation Analysis

No. of Species: 18

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1211641	1211835	+	NC_006177.1	Symbiobacterium thermophilum IAM 14863
2	1352254	1352451	+	NC_018870.1	Thermacetogenium phaeum DSM 12270
3	1377270	1377467	-	NC_014758.1	Calditerrivibrio nitroreducens DSM 19672
4	1517243	1517440	-	NC_014209.1	Thermoanaerobacter mathranii subsp. mathranii str. A3
5	1535537	1535734	-	NC_013921.1	Thermoanaerobacter italicus Ab9
6	1722512	1722703	+	NC_009633.1	Alkaliphilus metalliredigens QYMF
7	1839630	1839827	-	NC_015672.1	Flexistipes sinusarabici DSM 4947
8	1003641	1003826	-	NZ_LT632322.1	Murdochiella vaginalis
9	810951	811148	+	NC_014964.1	Thermoanaerobacter brockii subsp. finnii Ako-1
10	1654253	1654450	-	NC_015958.1	Thermoanaerobacter wiegelii Rt8.B1
11	1789718	1789924	-	NZ_LT906441.1	Cutibacterium granulosum
12	564481	564678	-	NZ_AP018795.1	Acidithiobacillus ferridurans
13	2319694	2319891	-	NC_011761.1	Acidithiobacillus ferrooxidans ATCC 23270
14	538512	538709	+	NZ_CP045571.1	Acidithiobacillus thiooxidans ATCC 19377
15	2523249	2523446	-	NC_015942.1	Acidithiobacillus ferrivorans SS3
16	2402784	2402981	+	NZ_CP026328.2	Acidithiobacillus caldus
17	2116044	2116241	-	NZ_CP017253.2	Clostridium taeniosporum
18	2433510	2433704	-	NZ_CP019650.1	Microbulbifer agarilyticus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_014209.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00707.24	1.0	18	19.0	same-strand	Translation initiation factor IF-3, C-terminal domain
2	PF05198.18	0.61	11	17	same-strand	Translation initiation factor IF-3, N-terminal domain
3	PF00453.20	1.0	18	21.0	same-strand	Ribosomal protein L20
4	PF01409.22	0.83	15	1502	same-strand	tRNA synthetases class II core domain (F)
5	PF02912.20	0.83	15	1493	same-strand	Aminoacyl tRNA synthetase class II, N-terminal domain
6	PF03483.19	0.72	13	1688	same-strand	B3/4 domain
7	PF17759.3	0.72	13	1688	same-strand	Phenylalanyl tRNA synthetase beta chain CLM domain
8	PF03147.16	0.72	13	1688	same-strand	Ferredoxin-fold anticodon binding domain
9	PF03484.17	0.72	13	1688	same-strand	tRNA synthetase B5 domain
10	PF01588.22	0.72	13	1688	same-strand	Putative tRNA binding domain
11	PF00587.27	0.78	14	637.0	same-strand	tRNA synthetase class II core domain (G, H, P, S and T)
12	PF03129.22	0.78	14	637.0	same-strand	Anticodon binding domain
13	PF07973.16	0.78	14	637.0	same-strand	Threonyl and Alanyl tRNA synthetase second additional domain
14	PF02824.23	0.78	14	637.0	same-strand	TGS domain